(data stored in ACNUC7421 zone)

EMBL: AE006468.YAIB

AE006468.YAIB        Location/Qualifiers
FT   CDS_pept        437100..437366
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yaiB"
FT                   /locus_tag="STM0383"
FT                   /product="putative cytoplasmic protein"
FT                   /note="similar to E. coli orf, hypothetical protein
FT                   (AAC73485.1); Blastp hit to AAC73485.1 (86 aa), 85%
FT                   identity in aa 1 - 85"
FT                   /db_xref="EnsemblGenomes-Gn:STM0383"
FT                   /db_xref="EnsemblGenomes-Tr:AAL19337"
FT                   /db_xref="GOA:Q7CR46"
FT                   /db_xref="InterPro:IPR019732"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q7CR46"
FT                   /protein_id="AAL19337.1"
FT                   /translation="MVMKNLIAELLLKLAQKEEESKELVAQVEALEIIVTAMLRNMAQN
FT                   EQEMLIRQVEGALEGVKPDASVPDHDTELLRQYVKKLLRHPRH"
     atggtcatga aaaatctcat agcagagttg ttgcttaagc tagcccaaaa agaagaagag        60
     tcgaaagaac tggttgctca ggtagaagcg ttagagatta tcgtcacagc aatgttacgt       120
     aacatggcgc aaaacgagca ggagatgttg atacgtcagg tagagggggc acttgaaggc       180
     gtaaagccgg atgccagcgt tcctgatcac gatacggaat tgctgcgcca atatgtaaaa       240
     aagttgctga gacacccccg gcactaa                                           267
//

If you have problems or comments...

PBIL Back to PBIL home page