(data stored in ACNUC7421 zone)

EMBL: AE006468.YAIV

AE006468.YAIV        Location/Qualifiers
FT   CDS_pept        428188..428811
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yaiV"
FT                   /locus_tag="STM0374"
FT                   /product="putative inner membrane protein"
FT                   /note="similar to E. coli orf, hypothetical protein
FT                   (AAC73478.1); Blastp hit to AAC73478.1 (222 aa), 71%
FT                   identity in aa 16 - 222"
FT                   /db_xref="EnsemblGenomes-Gn:STM0374"
FT                   /db_xref="EnsemblGenomes-Tr:AAL19328"
FT                   /db_xref="GOA:Q8ZRF7"
FT                   /db_xref="InterPro:IPR000595"
FT                   /db_xref="InterPro:IPR018490"
FT                   /db_xref="InterPro:IPR034719"
FT                   /db_xref="InterPro:IPR041687"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8ZRF7"
FT                   /protein_id="AAL19328.1"
FT                   /translation="MLSLSKPLQEFYRLDKCLSKHGTRFEFVNDKEIICSPDESNTHTF
FT                   VILEGVVSLVRGDKVLIGIVQAPFIFGLADGVAKKEAQYKLIAESGCIGYRLSSSQTLA
FT                   IIEQNQLWREAFCWIVWKSQVLELRDKQLIGNNSYDQIRATLMTMIEWDEELRSRIGVM
FT                   NYIHQRTRVSRSVVAEVLAALRKGNYIEMNKGKLISINRLPSEY"
     atgttatctt taagcaagcc actacaggaa ttctacagac tcgataaatg cctttctaag        60
     catggtacgc gtttcgagtt tgttaacgat aaagagatta tctgttcacc tgatgaaagt       120
     aatacccata cctttgttat tttagagggg gttgtttcgt tagttcgggg tgataaagtt       180
     cttattggta ttgtgcaggc cccttttatt tttggcttag ccgatggcgt ggcgaaaaaa       240
     gaggcacaat ataaattaat tgcggagagc ggttgcatcg gttatcgcct ctcatcatca       300
     caaactctcg ccatcattga gcagaaccaa ctgtggcgtg aagccttctg ttggatagta       360
     tggaaaagtc aggtactgga acttcgtgac aagcagctca ttggtaataa ttcttacgac       420
     caaattcgtg cgacgttaat gacaatgatt gagtgggatg aagaacttcg ctcacgtatt       480
     ggtgttatga attatattca tcaacgaacg cgcgtatcgc gatcggtggt ggcggaagtt       540
     ctcgcggccc tgcgtaaggg taattacatt gaaatgaata aaggcaaact gatcagtatt       600
     aaccgtttgc cctccgaata ttaa                                              624
//

If you have problems or comments...

PBIL Back to PBIL home page