(data stored in ACNUC7421 zone)

EMBL: AE006468.YAIW

AE006468.YAIW        Location/Qualifiers
FT   CDS_pept        431595..432689
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yaiW"
FT                   /locus_tag="STM0377"
FT                   /product="putative outer membrane lipoprotein"
FT                   /note="similar to E. coli orf, hypothetical protein
FT                   (AAC73481.1); Blastp hit to AAC73481.1 (364 aa), 85%
FT                   identity in aa 1 - 362"
FT                   /db_xref="EnsemblGenomes-Gn:STM0377"
FT                   /db_xref="EnsemblGenomes-Tr:AAL19331"
FT                   /db_xref="InterPro:IPR011673"
FT                   /db_xref="UniProtKB/TrEMBL:Q8ZRF4"
FT                   /protein_id="AAL19331.1"
FT                   /translation="MSAASRLYPLPFLAVAILAGCSSQSGQPVSKGEKPVDVASVVRQK
FT                   MPASVKDREAWAKDIATTFKSQGLAPTVENICSVLAVAQQESGYQADPVVPGLSKIAWQ
FT                   EIDRRAERLHIPLFLVHTALKINSPNGKSYSERLDTVKTEKQLSAIFDDFINMVPMGQT
FT                   LFGSYNPVHTGGPMQVSIAFAEQHAKGYPWKMTGTVRQEVFTRRGGLWFGTYHLLNYPA
FT                   NYSAPVFRFADFNAGWYASRNAAFQNAVSKASGVKLALDGDLIRYNSKEPGKTELAVRK
FT                   LAGQLGMSEREIRSQLEKGDSLAFEKTALYKKVYKLAEAKTGKTLAREMLPGIQLESPK
FT                   ITRKLTTAWFAKRVDERRARCMGR"
     atgtcggcgg cgtcccgtct ttatcctctg ccttttctgg cggttgccat attggctggc        60
     tgtagtagtc aatccgggca gccggtgagc aagggcgaga agcctgtcga cgtggcaagc       120
     gtagtacgtc agaaaatgcc agccagtgtc aaagacagag aggcctgggc gaaagatatc       180
     gcgacaacgt ttaagagcca ggggctggcg ccgacggtag aaaatatctg ttcggtgctg       240
     gctgtcgccc agcaggagtc cggttatcag gcggatcctg tcgtgccggg gctaagtaaa       300
     atcgcctggc aggagattga tcgccgcgct gaacgactac acatcccgct gtttctggtg       360
     cacaccgcgc tgaaaattaa ctcccccaac ggcaagagct atagcgaacg cctggacacg       420
     gtaaaaaccg aaaaacagct tagcgctatt tttgacgatt ttatcaatat ggtccctatg       480
     gggcagacgc tatttggctc atataacccg gtgcatacgg gcggcccgat gcaggtcagc       540
     attgcctttg ccgaacagca cgcgaaaggc tatccgtgga agatgacggg tacggtacgt       600
     caggaggtct ttacgcgccg tggcgggttg tggtttggaa cctaccattt gctgaattac       660
     ccggcgaact acagcgcgcc tgttttccgc ttcgccgact tcaacgcggg atggtacgcc       720
     agccgtaacg ctgcgttcca gaatgccgtc agtaaagcca gtggggtaaa actggcgctg       780
     gatggcgatc tgattcgtta taacagcaag gaaccgggca aaacagagtt agcggtacgc       840
     aaactggcag ggcagttggg aatgagtgag cgtgaaattc gcagccaact ggagaaaggc       900
     gatagcctgg cgtttgaaaa aacggcgctc tacaagaaag tctataaact ggccgaggcc       960
     aaaacgggca agacgcttgc gcgggaaatg ttgcccggta ttcaactgga aagtccgaag      1020
     atcacacgca agctgacgac cgcctggttt gctaaacgag ttgatgagcg gcgggcgcgg      1080
     tgtatggggc gataa                                                       1095
//

If you have problems or comments...

PBIL Back to PBIL home page