(data stored in ACNUC7421 zone)

EMBL: AE006468.YAIZ

AE006468.YAIZ        Location/Qualifiers
FT   CDS_pept        433303..433518
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yaiZ"
FT                   /locus_tag="STM0379"
FT                   /product="putative inner membrane protein"
FT                   /note="similar to E. coli orf, hypothetical protein
FT                   (AAC73483.1); Blastp hit to AAC73483.1 (114 aa), 84%
FT                   identity in aa 45 - 114"
FT                   /db_xref="EnsemblGenomes-Gn:STM0379"
FT                   /db_xref="EnsemblGenomes-Tr:AAL19333"
FT                   /db_xref="GOA:Q8ZRF3"
FT                   /db_xref="InterPro:IPR020490"
FT                   /db_xref="UniProtKB/TrEMBL:Q8ZRF3"
FT                   /protein_id="AAL19333.1"
FT                   /translation="MRLPVKIRRDWHYYAFSIGLIFILNGVVGLLGFEAKGWQTYGVGL
FT                   VTWIISFWLAGFIIRRREEDEVKDAR"
     atgcgtttgc ctgtaaaaat tcgtcgtgac tggcactact atgccttctc tattggcctt        60
     atctttattt tgaatggcgt cgtaggattg ctgggttttg aggctaaagg atggcaaacc       120
     tatggcgttg ggctggtaac atggattatt agcttctggc tggcggggtt cattattcgc       180
     cggcgcgaag aggatgaggt aaaagacgcc cgataa                                 216
//

If you have problems or comments...

PBIL Back to PBIL home page