(data stored in ACNUC7421 zone)

EMBL: AE006468.YAJB

AE006468.YAJB        Location/Qualifiers
FT   CDS_pept        complement(458886..459467)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yajB"
FT                   /locus_tag="STM0403"
FT                   /product="putative cytoplasmic protein"
FT                   /note="similar to E. coli putative glycoprotein
FT                   (AAC73507.1); Blastp hit to AAC73507.1 (193 aa), 87%
FT                   identity in aa 1 - 193"
FT                   /db_xref="EnsemblGenomes-Gn:STM0403"
FT                   /db_xref="EnsemblGenomes-Tr:AAL19357"
FT                   /db_xref="GOA:Q7CR41"
FT                   /db_xref="InterPro:IPR007431"
FT                   /db_xref="InterPro:IPR023491"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q7CR41"
FT                   /protein_id="AAL19357.1"
FT                   /translation="MNFLAHLHLAHLADSSLSGNLLADFVRGNPATHYPPDVVEGIYMH
FT                   RRIDVMTDNLPEVREAREWFRHETRRVAPITLDVMWDHFLSRHWTQISPDFPLQAFVGY
FT                   AHAQVATILPDSPPRFVNLNDYLWSEKWLERYRDMDFIQNVLNGMANRRPRLDALRDSW
FT                   YDLDAHYDALEERFWHFYPRMMAQAARKAL"
     atgaattttc ttgctcacct gcatctggcg caccttgccg acagctcgct ttccggtaat        60
     cttctggccg attttgtccg cggtaacccg gcaacgcatt atcctcctga cgtggtagag       120
     ggtatttata tgcatcggcg tattgacgtc atgaccgaca acctgccgga agttcgtgag       180
     gcgcgagagt ggttccgcca tgaaacgcgg cgcgtggcgc ccattacgct ggacgtcatg       240
     tgggatcatt ttttatcgcg tcactggacg caaatctctc ccgattttcc acttcaggcg       300
     tttgtcggct acgcccatgc gcaggtcgcg acgattctgc ccgactcccc gccgcgcttt       360
     gtcaacctga atgattatct ttggtcagaa aaatggttag agcggtatcg cgatatggat       420
     ttcattcaaa acgtgctgaa tggcatggcg aatcgccgtc cccggctgga tgccttgcgt       480
     gattcctggt acgatctgga cgcgcactac gacgcgttag aagagcgctt ctggcatttt       540
     tatccgcgta tgatggcaca ggccgcccgc aaagcgctgt ga                          582
//

If you have problems or comments...

PBIL Back to PBIL home page