(data stored in ACNUC7421 zone)

EMBL: AE006468.YAJC

AE006468.YAJC        Location/Qualifiers
FT   CDS_pept        461972..462304
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yajC"
FT                   /locus_tag="STM0406"
FT                   /product="preprotein translocase IISP family, membrane
FT                   subunit"
FT                   /note="similar to E. coli orf, hypothetical protein
FT                   (AAC73510.1); Blastp hit to AAC73510.1 (110 aa), 99%
FT                   identity in aa 1 - 110"
FT                   /db_xref="EnsemblGenomes-Gn:STM0406"
FT                   /db_xref="EnsemblGenomes-Tr:AAL19360"
FT                   /db_xref="GOA:Q7CR40"
FT                   /db_xref="InterPro:IPR003849"
FT                   /db_xref="UniProtKB/TrEMBL:Q7CR40"
FT                   /protein_id="AAL19360.1"
FT                   /translation="MSFFISDAVAATGAPAQGSPMSLILMLVVFGLIFYFMILRPQQKR
FT                   TKEHKKLMDSIAKGDEVLTNGGLVGRVTKVAEAGYIAIALNDTTEVVIKRDFVAAVLPK
FT                   GTMKAL"
     atgagctttt ttatttctga tgcggtagcg gcaacaggtg ctccagcgca gggcagcccg        60
     atgtctctga ttttaatgct ggtggtgttt ggtctgattt tctatttcat gatcctgcgc       120
     ccgcagcaga agcgcaccaa agagcacaaa aagctgatgg actccattgc gaaaggtgat       180
     gaagttctga cgaatggcgg tctggtcggt cgagtgacca aagtagcgga agccggctac       240
     attgccatcg cgctgaatga caccacggaa gtggttatca aacgtgactt cgtagctgcc       300
     gttctgccga aaggcaccat gaaggcgctg taa                                    333
//

If you have problems or comments...

PBIL Back to PBIL home page