(data stored in ACNUC7421 zone)

EMBL: AE006468.YAJD

AE006468.YAJD        Location/Qualifiers
FT   CDS_pept        466562..466909
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yajD"
FT                   /locus_tag="STM0411"
FT                   /product="putative cytoplasmic protein"
FT                   /note="hypothetical 12.6 Kda protein in secF-tsx intergenic
FT                   region. (SW:YAJD_SALTY)"
FT                   /db_xref="EnsemblGenomes-Gn:STM0411"
FT                   /db_xref="EnsemblGenomes-Tr:AAL19365"
FT                   /db_xref="GOA:P0A1S8"
FT                   /db_xref="InterPro:IPR002711"
FT                   /db_xref="InterPro:IPR003615"
FT                   /db_xref="UniProtKB/Swiss-Prot:P0A1S8"
FT                   /protein_id="AAL19365.1"
FT                   /translation="MAIIPKNYARLESGYREKALKLFPWVCGRCSREFVYSNLRELTVH
FT                   HIDHDHTNNPEDGSNWELLCLYCHDHEHSKYTEADQYGSTVIAGEDAQKDVGEATYNPF
FT                   ADLKAMMNKKK"
     atggctatca tcccaaaaaa ctacgcgcgc ctggaaagcg gctatcgtga aaaagcgctg        60
     aagctgtttc cgtgggtgtg cggacgttgt tcccgtgagt ttgtgtattc aaatctgcgt       120
     gagctgacgg tgcatcatat cgatcatgac cacaccaata acccggaaga cggcagcaac       180
     tgggagctat tgtgcctcta ctgccacgat catgagcatt ctaaatatac cgaagccgat       240
     cagtacggtt cgacggtcat tgccggggaa gatgcgcaaa aagatgtcgg cgaggcgact       300
     tataacccgt ttgccgatct gaaagcgatg atgaacaaaa agaaataa                    348
//

If you have problems or comments...

PBIL Back to PBIL home page