(data stored in ACNUC7421 zone)

EMBL: AE006468.YAJO

AE006468.YAJO        Location/Qualifiers
FT   CDS_pept        complement(473600..474574)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yajO"
FT                   /locus_tag="STM0421"
FT                   /product="putative oxidoreductase / K + channel protein"
FT                   /note="similar to E. coli putative NAD(P)H-dependent xylose
FT                   reductase (AAC73522.1); Blastp hit to AAC73522.1 (348 aa),
FT                   92% identity in aa 25 - 348"
FT                   /db_xref="EnsemblGenomes-Gn:STM0421"
FT                   /db_xref="EnsemblGenomes-Tr:AAL19375"
FT                   /db_xref="GOA:Q8ZRD2"
FT                   /db_xref="InterPro:IPR020471"
FT                   /db_xref="InterPro:IPR023210"
FT                   /db_xref="InterPro:IPR036812"
FT                   /db_xref="UniProtKB/TrEMBL:Q8ZRD2"
FT                   /protein_id="AAL19375.1"
FT                   /translation="MQYNTLGNTDLRVSRLCLGCMTFGEPSRGNHAWTLPEESSRPIIK
FT                   RALEGGINFFDTANSYSDGSSEEIVGRALRDFARRDEVVVATKVFHRVGDLPEGLSRAQ
FT                   ILRSIDDSLARLGMEYVDILQIHRWDYTTPIEETLEALNDVVKAGKARYIGASSMHASQ
FT                   FAQALALQKQHGWAPFVTMQDHYNLIYREEEREMLPLCWQEGVAVIPWSPLARGRLTRP
FT                   WGETTARLVSDDVGKNLYDESDKNDAQIAERLAGVSEALGATRAQVALGWLLSKRGVAA
FT                   PIIGASREEQLDELLNAVDLTLKPEQIAELETPYKQHPVVGFK"
     atgcaataca acacgttagg aaatacagat cttcgggtat cccgcctttg tctgggctgt        60
     atgacattcg gcgagccaag tcgcggcaat cacgcctgga cgcttcccga agagagcagc       120
     cgtcccatca tcaagcgcgc tcttgagggc ggcattaact tttttgatac cgccaacagc       180
     tactccgacg gcagcagcga agagattgtc ggtcgcgcgc tgcgtgattt tgcccggcgc       240
     gacgaggtgg tggtagcgac gaaagtcttc catcgcgtcg gcgatctgcc ggaaggattg       300
     tcccgcgcac aaatcctgcg ctctattgac gatagcctcg cccgtctggg aatggagtat       360
     gtcgatatcc tgcaaatcca ccgctgggat tacaccacgc cgatagaaga aactctggaa       420
     gcgctaaacg acgtggtaaa ggcgggtaaa gcccgctata tcggcgcttc ctcaatgcac       480
     gcctcacaat ttgcccaggc gctggcgcta caaaaacaac acggctgggc gccgtttgtc       540
     accatgcagg atcactataa cctgatctac cgcgaggaag agcgtgagat gctaccgctg       600
     tgctggcagg aaggcgttgc cgtgattccg tggagtccgc tggcgcgcgg gcgcttaact       660
     cgcccctggg gagaaaccac ggcccgcctg gtctcggatg acgtgggtaa aaatttatac       720
     gatgaaagcg ataaaaatga tgcgcaaata gcggaacggc tggctggcgt cagcgaggcg       780
     cttggcgcaa cgcgggcgca ggttgcgctg ggctggctgc tcagcaaacg aggcgtcgcc       840
     gcgccgatta tcggcgcttc gcgtgaagaa cagttagatg agttgctgaa tgccgttgat       900
     ttaacgctca aaccggagca gattgccgaa ctcgaaacgc cgtacaaaca gcatccggta       960
     gtgggattta aataa                                                        975
//

If you have problems or comments...

PBIL Back to PBIL home page