(data stored in ACNUC7421 zone)

EMBL: AE006468.YBAL

AE006468.YBAL        Location/Qualifiers
FT   CDS_pept        complement(550353..552029)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ybaL"
FT                   /locus_tag="STM0492"
FT                   /product="putative CPA2 family transport protein"
FT                   /note="similar to E. coli putative transport protein
FT                   (AAC73580.1); Blastp hit to AAC73580.1 (558 aa), 94%
FT                   identity in aa 1 - 556"
FT                   /db_xref="EnsemblGenomes-Gn:STM0492"
FT                   /db_xref="EnsemblGenomes-Tr:AAL19446"
FT                   /db_xref="GOA:Q8ZR99"
FT                   /db_xref="InterPro:IPR003148"
FT                   /db_xref="InterPro:IPR004771"
FT                   /db_xref="InterPro:IPR006153"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="InterPro:IPR038770"
FT                   /db_xref="UniProtKB/TrEMBL:Q8ZR99"
FT                   /protein_id="AAL19446.1"
FT                   /translation="MHHATPLITTIVGGLVLAFILGMIANKLRISPLVGYLLAGVLAGP
FT                   FTPGFVADTKLAPELAELGVILLMFGVGLHFSLKDLMAVKSIAIPGAVAQIAVATLLGM
FT                   ALSAVLGWSLMTGIVFGLCLSTASTVVLLRALEERQLLDSQRGQIAIGWLIVEDLVMVL
FT                   TLVLLPAVAGMVEKGDVGIASLTVDMGITIGKVVAFIAIMMLVGRRLVPWIMARSAATG
FT                   SRELFTLSVLALALGIAFGAVELFDVSFALGAFFAGMVLNESELSHRAAHDTLPLRDAF
FT                   AVLFFVSVGMLFDPLVLIQQPLAVLATLAIIVFGKSIAAFFLVRLFGHSPRTALTIAAS
FT                   LAQIGEFAFILAGLGMALNLLPQAGQNLVLAGAILSIMLNPVLFTLLEKYLAKTETLEE
FT                   QTLEEAIEEEKQIPVDICNHALLVGFGRVGSLLGEKLLAAGIPLVVIETSRTRVDELRE
FT                   RGIRAVLGNAANEEIMNLAHLDCARWLLLTIPNGYEAGEIVASARGKSPDIEIIARAHY
FT                   DDEVKYITERGANQVVMGEREIARAMLELLETPPAGEVVAS"
     atgcatcacg ctaccccgct tatcaccacc attgtcggcg gccttgtgct cgcttttatt        60
     ctcggcatga ttgccaacaa attgcgtatt tctccactgg tgggatatct gttagcgggc       120
     gttctggcgg gaccttttac cccgggtttt gttgcggata ccaaactggc gccggagctg       180
     gcggagctcg gcgtgattct attgatgttc ggcgtcgggc tgcatttttc gctgaaggat       240
     ttgatggcgg taaagtctat cgccattccc ggcgctgtcg ctcagatagc ggtggcgacg       300
     ctgctgggta tggcgctttc cgccgtgctg ggatggtcat taatgaccgg catcgttttt       360
     gggctctgtc tgtctacagc cagtaccgtc gtcctgctgc gcgcgcttga ggagcgacaa       420
     ctccttgata gccagcgcgg gcaaatcgcc atcggctggc tgattgtcga agatctggtg       480
     atggtgctga cgctggtctt gctgcccgcc gttgccggca tggtggaaaa aggcgatgtc       540
     ggcatagcct cgctgacagt cgatatgggg ataaccattg gtaaagtggt ggcgtttatc       600
     gccatcatga tgctggtcgg acgccgcctg gtgccgtgga ttatggcccg cagcgccgcc       660
     accggctcgc gcgaattatt taccctttcc gtactggcgc tggcgttagg cattgcgttt       720
     ggcgcggtag aactgtttga cgtctctttt gcgctgggcg cgttcttcgc tggaatggtg       780
     cttaatgagt cggaactgag tcaccgggcg gcgcacgata cgttgccgct gcgcgacgcc       840
     tttgccgtcc tgttttttgt ttccgtcggc atgttgttcg atccgttagt cttgattcaa       900
     cagccgctgg cggtgttggc gacgcttgcc attatcgtct ttggcaaatc gatcgctgcg       960
     tttttcctgg tgcgtttgtt cggccactcg ccgcgaaccg cgctgaccat tgccgccagc      1020
     ctggcgcaaa tcggcgagtt cgcctttatt ctcgccgggc tcggcatggc gctcaacctg      1080
     ctgccgcaag cgggacagaa cctggtgctg gcaggcgcta ttttgtcgat tatgcttaat      1140
     cccgtactgt ttaccctgct ggagaagtat ctggcgaaaa ccgaaacgct ggaagagcaa      1200
     actctggaag aggctatcga agaagagaag caaattccgg tggatatctg taatcatgcc      1260
     ctgctggtgg gttttggccg cgtaggcagt ctgctgggag aaaaattact ggcggcgggg      1320
     attccgctgg tggttatcga aacgtcccgt acccgcgtgg atgaactgcg cgaacgcggg      1380
     attcgcgccg tactgggcaa cgccgctaac gaagaaatca tgaatctggc gcatctggac      1440
     tgcgctcgct ggctgttatt gaccatcccc aacggttacg aagccggtga gattgtcgcc      1500
     tcagcgcggg gaaaaagtcc tgatatcgag ataatcgccc gcgcgcacta tgatgatgaa      1560
     gtgaaatata ttaccgagcg gggagccaat caggtagtga tgggcgagcg agaaattgcc      1620
     cgggcgatgc tggaactgct tgaaacgccg cccgcgggtg aagtcgtcgc cagttaa         1677
//

If you have problems or comments...

PBIL Back to PBIL home page