(data stored in ACNUC7421 zone)

EMBL: AE006468.YBAP

AE006468.YBAP        Location/Qualifiers
FT   CDS_pept        complement(556087..556881)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ybaP"
FT                   /locus_tag="STM0496"
FT                   /product="putative cytoplasmic protein"
FT                   /note="similar to E. coli putative ligase (AAC73584.1);
FT                   Blastp hit to AAC73584.1 (264 aa), 66% identity in aa 1 -
FT                   264"
FT                   /db_xref="EnsemblGenomes-Gn:STM0496"
FT                   /db_xref="EnsemblGenomes-Tr:AAL19450"
FT                   /db_xref="InterPro:IPR002816"
FT                   /db_xref="UniProtKB/TrEMBL:Q8ZR97"
FT                   /protein_id="AAL19450.1"
FT                   /translation="MELLNQLKRLWRALRGTPNSWPAIDLSLPGGRHLHLVGSIHMGTR
FT                   DMAPLPAKLVKKLHQADALVVEADISGNETPFSNLPKCPPLVERLSAGQLSALEKRVSE
FT                   LGMPLIHFDNQPLWQIAMVLQATQAQRLGLRPDYGIDYQLLQAAREMSLPVQELEGAKH
FT                   QLELLCDLPDGGMALLDDTLTHWHTNARLLQVMIGWWLEQPPTSVGASLPRTFSQPLYD
FT                   VLMVKRNEAWRDALLALPPGRYVVAVGALHLYGEGNLPQILK"
     atggagctat taaatcaact taaacgttta tggcgcgcgc tgcgtggtac cccaaatagt        60
     tggcctgcta tcgatctctc cctgcccggc ggtcgtcatc tgcatctggt tggcagtatt       120
     catatgggga cgcgcgatat ggctcctctt ccagcaaagc tggtgaaaaa gctacaccag       180
     gccgacgcgc tggtcgttga agcggatatt tctggtaacg aaacgccatt cagcaatctc       240
     cccaaatgcc cgccgttggt cgaacgtctc agcgccgggc agctaagcgc actggaaaaa       300
     cgggtcagtg agttgggtat gccgctgatc cattttgata atcaaccttt atggcagata       360
     gctatggtgc tacaggccac gcaggcgcaa cggctgggat tgcgcccgga ctatggcatt       420
     gattatcagc tattacaggc tgcccgcgaa atgtcgctgc cggtgcaaga gctggaaggg       480
     gcgaaacacc agctcgaact actctgcgat ctgcccgatg gcgggatggc gctgctcgac       540
     gacacgctga cgcactggca caccaacgca cggcttttgc aggtgatgat cggctggtgg       600
     cttgagcagc cgccgaccag cgtcggcgct tcgctcccca gaacgtttag ccagccgctg       660
     tatgatgtac tgatggtgaa acgcaatgaa gcctggcgcg acgcgctgct ggcactgccg       720
     ccgggacgct acgtggtagc cgtaggggcg ctacatctgt acggcgaagg caacctaccg       780
     caaatattga aataa                                                        795
//

If you have problems or comments...

PBIL Back to PBIL home page