(data stored in ACNUC7421 zone)

EMBL: AE006468.YBAW

AE006468.YBAW        Location/Qualifiers
FT   CDS_pept        511168..511566
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ybaW"
FT                   /locus_tag="STM0454"
FT                   /product="putative esterase"
FT                   /note="similar to E. coli orf, hypothetical protein
FT                   (AAC73546.1); Blastp hit to AAC73546.1 (132 aa), 94%
FT                   identity in aa 1 - 132"
FT                   /db_xref="EnsemblGenomes-Gn:STM0454"
FT                   /db_xref="EnsemblGenomes-Tr:AAL19409"
FT                   /db_xref="GOA:Q7CR23"
FT                   /db_xref="InterPro:IPR006684"
FT                   /db_xref="InterPro:IPR029069"
FT                   /db_xref="UniProtKB/TrEMBL:Q7CR23"
FT                   /protein_id="AAL19409.1"
FT                   /translation="MQTQIKVRGYHLDVYQHVNNARYLEFLEEARWDGLENSDSFQWMT
FT                   ARNIAFVVVNININYRRPAVLSDLLTVTSQVQQLNGKSGVLSQTITLEPEGQVVADALI
FT                   TFVCIDLKTQKALPLEGELREKLEQMVQ"
     atgcaaacac aaatcaaagt tcgtggatat catcttgatg tttatcaaca tgttaataat        60
     gcccgctatc tggagtttct ggaagaagcc cgttgggatg gtctggaaaa cagcgacagc       120
     tttcagtgga tgacggcccg caatattgcc tttgtggtgg taaacatcaa tataaattac       180
     cgtcgcccgg cggtattgag cgatctattg accgtgacca gccaggtaca acagcttaac       240
     ggtaaaagcg gcgtattaag ccagacgatt acgctggagc cagaagggca ggtggtggcc       300
     gatgcgctca tcacgtttgt ttgtattgat ttaaaaacgc aaaaagcgct gccgctggaa       360
     ggcgaattgc gtgaaaagct ggaacagatg gtgcaataa                              399
//

If you have problems or comments...

PBIL Back to PBIL home page