(data stored in ACNUC7421 zone)

EMBL: AE006468.YBAX

AE006468.YBAX        Location/Qualifiers
FT   CDS_pept        complement(511672..512367)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ybaX"
FT                   /locus_tag="STM0455"
FT                   /product="putative (aluminum) resistance protein"
FT                   /note="similar to E. coli orf, hypothetical protein
FT                   (AAC73547.1); Blastp hit to AAC73547.1 (231 aa), 93%
FT                   identity in aa 1 - 231"
FT                   /db_xref="EnsemblGenomes-Gn:STM0455"
FT                   /db_xref="EnsemblGenomes-Tr:AAL19410"
FT                   /db_xref="GOA:Q7CR22"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR018317"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q7CR22"
FT                   /protein_id="AAL19410.1"
FT                   /translation="MKRAVVVFSGGQDSTTCLAQARHQYDEVHCVTFDYGQRHRAEIDV
FT                   ARALALKLGARAHKVLDVTLLNELAVSSLTRDSIPVPDYEPNADGIPNTFVPGRNILFL
FT                   TLAAIYAYQVKAEAVITGVCETDFSGYPDCRDEFVKALNHAVNLGMAKDIRFETPLMWI
FT                   DKAETWALADYWGQLDLVREETLTCYNGIKGDGCGHCAACNLRANGLNHYLSNKAAVMA
FT                   AMKQKTGLR"
     atgaaacgcg ccgttgttgt atttagtgga ggtcaggact ccaccacttg tctggcgcaa        60
     gcgcggcatc agtatgatga agtgcattgt gtcacgtttg attatggtca gcgccaccgc       120
     gcagagattg atgtcgcgcg ggcgctggcg ttaaaacttg gcgcacgcgc gcataaagtg       180
     ctggatgtca ctttgctgaa cgaactggcg gtcagcagcc tgacgcggga tagcattccg       240
     gtgccggact atgaaccgaa cgctgacggt atccccaata ctttcgtacc gggacgcaat       300
     attctctttc tgacgctggc ggcgatttac gcttatcagg ttaaagccga agcggtgatc       360
     actggcgttt gcgagaccga tttttccggc tatccagact gtcgcgatga gttcgtcaaa       420
     gcgctgaatc acgcggtgaa tctgggcatg gcgaaagata tccgtttcga aacgccctta       480
     atgtggattg ataaagctga aacctgggcg ctggccgatt attggggcca actggatttg       540
     gttcgcgaag agacgctgac ctgctataac ggcattaaag gcgatggctg tggtcattgc       600
     gcagcctgta atctgcgcgc taacggcctg aatcattatc tgtcgaataa agcggcggtg       660
     atggcagcaa tgaagcaaaa aaccgggtta aggtga                                 696
//

If you have problems or comments...

PBIL Back to PBIL home page