(data stored in ACNUC7421 zone)

EMBL: AE006468.YLAB

AE006468.YLAB        Location/Qualifiers
FT   CDS_pept        complement(524580..526130)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ylaB"
FT                   /locus_tag="STM0468"
FT                   /product="putative diguanylate cyclase/phosphodiesterase
FT                   domain 2"
FT                   /note="similar to E. coli orf, hypothetical protein
FT                   (AAC73559.1); Blastp hit to AAC73559.1 (518 aa), 67%
FT                   identity in aa 3 - 518"
FT                   /db_xref="EnsemblGenomes-Gn:STM0468"
FT                   /db_xref="EnsemblGenomes-Tr:AAL19422"
FT                   /db_xref="GOA:Q8ZRB0"
FT                   /db_xref="InterPro:IPR001633"
FT                   /db_xref="InterPro:IPR024744"
FT                   /db_xref="InterPro:IPR035919"
FT                   /db_xref="UniProtKB/TrEMBL:Q8ZRB0"
FT                   /protein_id="AAL19422.1"
FT                   /translation="MTTRHLVSLVTGVLILSVLFPIGLSLWLAHRQVEKRFNEELDIFS
FT                   SRVALRTERVSDQAKAALTHIASFKGEPCSSAHLLAMRRVSYSFRYVQEVLYLKNSIPV
FT                   CSSLEKESHIPAFPPPMKITRDGYRAWFTAQNDLGIKRYMAALGSDSYIVMIDPASFID
FT                   VIPFGAWPIDVAIIGRERNTVVASSGNLDPAILPLIHHETPLRLENRGIQYAIHPFPEM
FT                   GITIVSWAPTAPLERSWYRQAFIWLPAGIVTGLLAAAFILRILRRLQSPRHRLQDAIDN
FT                   REINVHYQPIVSLSSGKIVGAEALARWQQADGTFLSPEIFIALAEQTGLTEPLTRLIID
FT                   TVFEDMGSWLKSHPEQHISINLEASDLASETLPTLLSTLLNRSQISPSQIALELTEREF
FT                   ADPKTSAPIVARYRNAGHSIYIDDFGTGYSSLSYLQNLDVDVLKIDKSFVDALEYKNVT
FT                   PHIIEMAKTLKLKMVAEGIETARQEQWLRQHGVHYGQGWLYSKPLPATAFILWAEQRL"
     gtgacaacac gacatctggt cagcctggta acgggagtgc ttatcctgtc tgtccttttc        60
     ccgataggat tgagtctgtg gctggcgcac cgtcaagttg aaaagaggtt taatgaagag       120
     ctggatatct tctcgtcccg ggtggcgcta cgtacagaaa gggtcagtga ccaggcaaaa       180
     gccgcgttaa cgcatattgc ctcctttaaa ggcgagccct gcagcagtgc ccatttactc       240
     gccatgcgcc gcgtgtctta tagctttcgg tatgtccagg aagttctgta tcttaaaaat       300
     tcgattcccg tttgctcctc acttgaaaaa gagagccata ttcccgcgtt ccctccgccc       360
     atgaaaatca ctcgcgacgg ttatcgcgcc tggtttacgg cgcaaaacga tctgggtata       420
     aaacgctata tggcggcact cgggagcgac agctatatcg tgatgatcga cccggcgtcc       480
     tttatcgatg tgattccgtt tggcgcatgg ccgattgacg tcgctattat tggccgggaa       540
     cgcaatactg tggttgccag cagcggtaac cttgaccccg ctattcttcc gctcattcac       600
     catgagacgc ccctgcggct ggaaaaccga ggcattcagt atgctatcca cccctttccg       660
     gaaatgggca ttactatcgt aagctgggca ccgaccgctc cgctggaaag gagctggtat       720
     cgacaggcgt ttatctggct accggcgggc atcgtaacgg gtctgctggc cgcggccttt       780
     attctgcgta ttttgcgtcg actacagtcg ccccgccacc gtctccagga tgcgatagac       840
     aatcgcgaaa ttaacgtaca ctatcagcct attgtctccc tgagcagcgg aaaaattgtc       900
     ggtgccgaag ccttagctcg ctggcaacag gcggacggca ccttcctttc gccggaaatt       960
     tttatcgcgc tggctgaaca aaccgggctc acggagccgc taacccggct aatcatcgac      1020
     accgtttttg aagacatggg gagttggtta aagtcccatc ccgaacaaca tatttcaatc      1080
     aatcttgagg catccgatct ggcgtcggaa acgttgccga cgctgttaag cacgctgctg      1140
     aaccgtagcc aaatttctcc gtcgcaaatc gcgcttgagt taacggaacg cgagttcgcc      1200
     gatccgaaaa ccagcgcgcc cattgtcgcc agataccgta acgcgggaca ttcaatttat      1260
     attgatgact ttggcaccgg ctattccagc ctcagctact tacaaaatct ggatgtggat      1320
     gtccttaaaa ttgataaatc ttttgtcgat gcgctggaat ataaaaacgt cacgccgcat      1380
     attattgaaa tggcgaaaac gctcaaactt aagatggtcg cagaaggcat cgaaacggcc      1440
     aggcaagaac agtggctacg ccagcatggc gtacattatg gtcagggctg gttatacagt      1500
     aaacccctac ccgctacggc atttattctt tgggcggaac agcggctata a               1551
//

If you have problems or comments...

PBIL Back to PBIL home page