(data stored in ACNUC7421 zone)

EMBL: AE006468.YLAC

AE006468.YLAC        Location/Qualifiers
FT   CDS_pept        complement(526817..527287)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ylaC"
FT                   /locus_tag="STM0471"
FT                   /product="putative inner membrane protein"
FT                   /note="similar to E. coli orf, hypothetical protein
FT                   (AAC73560.1); Blastp hit to AAC73560.1 (169 aa), 80%
FT                   identity in aa 14 - 168"
FT                   /db_xref="EnsemblGenomes-Gn:STM0471"
FT                   /db_xref="EnsemblGenomes-Tr:AAL19425"
FT                   /db_xref="GOA:Q8ZRA9"
FT                   /db_xref="InterPro:IPR019713"
FT                   /db_xref="UniProtKB/TrEMBL:Q8ZRA9"
FT                   /protein_id="AAL19425.1"
FT                   /translation="MTEIQRLLSETIDDLNIREKRDNRPRFSISFIRKHPGLFIAMYAA
FT                   WFATLAVMLQSETLVGSVWLLVVLFIAFNGFFFFDIAPRYHYNDIDVLDLRVCYNGEWY
FT                   NTRFVPPTLIETILQSPQVDNEHKVQLQKMVARKGELSFYDIFTLARAEASR"
     atgacagaga tacagcgcct gcttagcgaa actattgatg acttaaacat ccgtgaaaaa        60
     cgcgataaca ggccgcgttt tagtatcagt tttatccgca agcatcctgg gttatttatc       120
     gcgatgtatg cagcctggtt tgcgacgctg gcggtcatgc tgcaatcaga aacgctggtg       180
     gggtcagtgt ggctgttagt ggtgttattt atcgcattta atggcttctt ctttttcgac       240
     atcgccccgc gttatcacta taacgacatc gatgtgctgg acctccgggt ctgttacaac       300
     ggcgaatggt acaacacccg ctttgttccc cccacgctca ttgagacgat tcttcagtct       360
     ccacaggtgg ataatgaaca taaagtccag ctgcaaaaaa tggttgcccg taagggcgaa       420
     ctttccttct acgatatttt tacgctggcc cgcgcagaag ccagccggta a                471
//

If you have problems or comments...

PBIL Back to PBIL home page