(data stored in SCRATCH3701 zone)

EMBL: AE017197.ACRD

AE017197.ACRD        Location/Qualifiers
FT   CDS_pept        complement(199425..202451)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="acrD"
FT                   /locus_tag="RT0161"
FT                   /product="acriflavin resistance protein D"
FT                   /db_xref="EnsemblGenomes-Gn:RT0161"
FT                   /db_xref="EnsemblGenomes-Tr:AAU03645"
FT                   /db_xref="GOA:Q68XJ7"
FT                   /db_xref="InterPro:IPR001036"
FT                   /db_xref="InterPro:IPR027463"
FT                   /db_xref="UniProtKB/TrEMBL:Q68XJ7"
FT                   /protein_id="AAU03645.1"
FT                   /translation="MLLSTICIKRPVFATVLSLMIVALGGIFFTKLQIRSAPDISVPII
FT                   NVEAHYEGADALYMEQEITTRIEKVLKTVKNLHYITSQSSTGSSSITLSFRLSTDIEVA
FT                   LNDVRSKISDISYMFPQDMKVPSVAKLDPDNFPSLFISVESDQYSDLELTQIISNNLQS
FT                   TLDKLESVGKTQIYGGRKYIMRIEPDFKKLYQYKISLLDIETAIKEQNKDYPAGTIKTK
FT                   SNNFIVTLIGSLSTPEEFGNIIIKEQNGCIIKLQDITKISLTSPDEDIIFRYNGKNSIA
FT                   LGLIKESKANIINLSNEVTKELERIKDSIPKGISISIAYDGAKPLKASIYAVFQTMFEA
FT                   LILVVLVTYLFLASAKISLIPFVTIPVSLIGTFSVMYAFGFSINVFTLLAMILAIGLVV
FT                   DDAIVMLENIFRYNEMGYKPIEASMLASKEIGFAIITMTITLAAVFIPIGFIEGFIGKL
FT                   FIEFAWTLAFCVLFSGFVAVTLTPMMSSHIVTKHNKNFAKFLVRFHDILQFVQNRYIYY
FT                   LKLALDNKKKFVIIILSSCIVLIISFKFTNKTFVPQEDDGFLQVFLKGPEGSSLEFSIK
FT                   VVKEAEQILANYKDILGYLMVIGVGGSENVFGFIQLKDWSERSHSQKTIKNMLNKQFSK
FT                   IPGMSIFAMDPRSMVSMNASSPIEFTIQTNLEYEDLDKISQQFIDIMQTKPIFLNVNRN
FT                   LQSAIPTINIEVNRDKAYLYGMDLANIGKTLEYLLAGRQIGAFRMGNNLYDVILQFNQK
FT                   DRQNISDLSKILIRTKNNNMLPLESIANIKEKISFKSYYHYNNSKSVTISSDLAPNVKI
FT                   NDAINIINKIATQLLDPNNAIIEYIGEIKQMEEIDNNILITFVFSLVFIYLVLAAQFES
FT                   FTDPLLILLAVPFSITGGVLALLITGDSINMYSNIGLITLIGLVTKNSIMIVEFANQIR
FT                   AKGVNVREAIIESSKLRLRPILMTTITAIVGALPLVFADGAGAAARNSIGFVIVGGLSI
FT                   GTIFTIFVIPVIYQTFKKD"
     atgttattgt ctacaatttg tattaagcgt ccagtatttg ctacagtttt gagtctaatg        60
     atcgtagctc tcggaggaat tttttttacc aagctacaaa ttagaagtgc tccggatatt       120
     tcagttccca ttataaatgt tgaagcacat tatgaaggtg cagatgcatt atatatggaa       180
     caagaaataa cgacacgtat agaaaaagtt ttaaagactg ttaaaaattt acattatata       240
     acgtctcaaa gttctaccgg ctcaagtagt attactttgt catttcgatt atctacagat       300
     attgaagtag cattaaacga tgtgcgttct aaaatatcag atattagtta tatgtttcca       360
     caagatatga aagtaccatc agttgcgaaa cttgatcctg ataattttcc aagcctcttc       420
     ataagtgttg aaagtgatca atatagcgat ttagaattaa cacagatcat ctcaaataat       480
     ttacaaagca cattagataa acttgaaagt gtaggcaaaa cacaaattta cggcggtagg       540
     aaatatataa tgaggataga accagatttc aaaaaattat atcaatataa aatttcttta       600
     ttggatatcg aaactgcaat aaaagagcaa aataaagatt atccagcagg aacgattaaa       660
     acaaaaagta ataattttat agtaactctt ataggctctt tatcaacacc agaagaattc       720
     ggtaatatta ttataaaaga acaaaatgga tgtatcataa aattacaaga tataacaaaa       780
     atatctttaa cttcacctga tgaggatata atttttagat ataacggcaa aaactctatt       840
     gctcttggtc ttataaaaga atcaaaagct aatatcatca atttatcaaa tgaagtaact       900
     aaagaattag aaagaattaa agactcaata ccaaaaggaa taagcattag tatagcatat       960
     gatggggcga aacctttaaa ggcatcaatt tatgcggtat ttcaaacaat gtttgaagcg      1020
     ttaatattgg tagttttagt aacttatttg tttcttgctt ctgctaaaat tagcttaatt      1080
     ccatttgtaa caattcctgt atcgttgatc ggtactttta gcgtaatgta tgcttttgga      1140
     ttttctatta atgtatttac actccttgct atgatacttg ctataggttt agtcgtcgat      1200
     gatgcgatag tgatgcttga aaacattttt agatataatg aaatggggta taaacccata      1260
     gaagcttcta tgcttgcgtc taaagaaatt ggctttgcaa taatcactat gactattaca      1320
     cttgctgcag tgtttatacc aataggtttt attgaaggct ttatcgggaa attatttatt      1380
     gaatttgctt ggactttagc attttgcgtt ttgttctcag gatttgtcgc tgtcacttta      1440
     acgcctatga tgtcaagtca tattgttaca aaacataaca aaaactttgc aaaattttta      1500
     gtaagatttc atgatattct acaatttgtt caaaatagat atatttatta tctaaagtta      1560
     gctttagata ataaaaagaa atttgtcatc attattttat catcatgtat agtattgatt      1620
     attagtttta aatttactaa caaaactttc gtaccacaag aagatgacgg atttttacaa      1680
     gtttttctca aagggcctga aggttctagt ttagaatttt ctattaaggt agtaaaagaa      1740
     gcagaacaaa tccttgctaa ttataaagat atattaggtt atctgatggt aataggtgta      1800
     ggcggtagtg aaaatgtttt tggattcatt cagttaaaag actggagcga acgttctcac      1860
     tcacaaaaaa ctattaagaa tatgttaaat aagcaatttt ctaaaatacc tggtatgtcg      1920
     attttcgcca tggatccacg ttcaatggtt agcatgaatg caagtagtcc tatagaattt      1980
     actattcaaa caaacctgga atatgaggat ttagataaaa tatcgcaaca atttattgat      2040
     ataatgcaaa caaagcccat tttcttaaac gtcaatagaa atttacaatc agcaatacct      2100
     actataaata tagaagtaaa ccgtgataag gcttacttat acggaatgga tttagcgaat      2160
     ataggtaaaa cattagaata tttactggca ggtcgacaaa ttggtgcttt tagaatgggc      2220
     aataatttat atgatgtaat attacaattt aatcaaaaag atcggcaaaa tattagtgat      2280
     ttgagtaaaa ttttaatcag aacaaaaaat aataacatgt taccgcttga atcaatagct      2340
     aatattaagg aaaaaatatc attcaaatca tattatcatt ataataattc aaaatctgtt      2400
     actatttctt ccgatcttgc tcctaacgta aaaattaatg atgcaattaa cataatcaat      2460
     aaaatagcca ctcagttact tgatcctaat aatgctataa ttgaatatat cggagaaatt      2520
     aaacaaatgg aagaaataga caataatata cttataacat ttgtattttc gcttgtattt      2580
     atctatttag tacttgcagc tcaatttgaa agctttactg atcctttatt aatattactc      2640
     gccgtacctt tctcaataac cggcggggta cttgcactct tgattactgg tgatagtatt      2700
     aatatgtata gtaatattgg acttattact ttaattggat tagttactaa gaattctatt      2760
     atgatagtag aatttgctaa tcagataaga gcaaaaggtg taaatgttcg agaagctata      2820
     atagaatctt caaaactgcg attacgtccg attcttatga ctaccattac tgctatagtc      2880
     ggagcattac ctctagtttt tgcagatggc gccggtgctg ctgctcgtaa ttctataggt      2940
     tttgtaatag ttggtgggtt aagtatcggt actatattta caatttttgt tatacctgta      3000
     atatatcaaa cttttaagaa ggattaa                                          3027
//

If you have problems or comments...

PBIL Back to PBIL home page