(data stored in SCRATCH3701 zone)

EMBL: AE017197.AMPG1

AE017197.AMPG1       Location/Qualifiers
FT   CDS_pept        complement(591272..592603)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ampG1"
FT                   /locus_tag="RT0462"
FT                   /product="murein peptide permease protein AmpG"
FT                   /db_xref="EnsemblGenomes-Gn:RT0462"
FT                   /db_xref="EnsemblGenomes-Tr:AAU03937"
FT                   /db_xref="GOA:Q68WQ5"
FT                   /db_xref="InterPro:IPR004752"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q68WQ5"
FT                   /protein_id="AAU03937.1"
FT                   /translation="MLKNSHVCIIIWLFGFISGFNIMITGNTLNYWFAKKDIALQTIGI
FT                   LSFITLPYSINFLLAPVFDTVQIKCLNKILGHRLSWICLTSTTLISLTSILSFLDPGTD
FT                   LVLLSFIAFIISFFSATQDTILSALRTEIVPKELLGFTSGIYIFGYRVGMLLASSGAIY
FT                   LSIYLTFNKIYQIFACVIFVYLILLILVSRYTNSVDVIEENTSYFYVARCYTMEEMHLK
FT                   NEFFIKHYFNFFKNCISAYLLKIFSGSHVYRNDISLAYFIVLILIFLVLYRLPDNLINV
FT                   MINPFLLHLGYNAFEIASVCKFCGVIGAIIGGLIGGIIMKYKNMLYSILLFGIIHALSH
FT                   ILFILLEVNGKNSLILFITIGIESITGGMTMTAYIAFISSLCQGKFRATQYSLLSSMMG
FT                   ISRSIFPIISGYMVVNFGWQNFFLFTTIITIPSLLILLKIQTKL"
     atgttaaaaa actctcatgt atgtattata atttggttat ttggatttat tagcggcttt        60
     aatataatga ttaccggtaa tactttaaat tattggtttg ctaaaaaaga tatcgcgttg       120
     caaacaattg gcatattatc attcataaca ctcccatatt ctattaattt tttgttagca       180
     ccagtttttg atacagtaca aattaagtgt ttaaacaaaa tattaggtca tagattatct       240
     tggatttgcc taactagtac aacattaata tctcttacat ctattctcag ctttctagat       300
     cctggtactg atctagtatt attatcattt attgctttta ttatatcttt ttttagtgca       360
     acacaagata ctatactaag cgctttaaga acagaaatag ttcctaaaga attacttgga       420
     tttacttcag gaatatatat attcggttat cgagtaggta tgcttttagc aagttctggg       480
     gctatttatt tatctattta tttaacattt aataaaatat atcaaatctt tgcttgtgta       540
     atatttgttt atttaatttt acttattcta gtttcaagat ataccaattc tgttgatgtc       600
     atagaagaaa atacatctta tttttatgtt gcacgatgtt atacgatgga agaaatgcac       660
     ctaaaaaatg agttttttat aaaacattac tttaattttt ttaaaaattg tatatccgcc       720
     tatttattaa agattttctc aggttctcac gtctatagga atgatataag cttagcatac       780
     ttcattgttc ttatattaat ttttctagta ttatatagat taccagataa cttaattaat       840
     gttatgatta atccgttttt gcttcacctt ggatataatg ctttcgaaat cgcaagtgtt       900
     tgcaagtttt gtggtgttat aggagctata atcggtggac tcatcggtgg tattattatg       960
     aaatataaaa atatgttata tagtatatta ttatttggta taattcacgc tttaagtcat      1020
     attttattta ttttgcttga agtaaacggt aaaaattctt taatattatt tattacgata      1080
     ggaatagaaa gtattactgg aggtatgact atgactgcat atattgcttt tatttcttca      1140
     ctttgtcaag gtaaattccg cgctactcaa tattctttgc tttcatcgat gatgggaatt      1200
     tcacgttcaa ttttccctat aatttcaggc tatatggtag taaattttgg ttggcaaaat      1260
     ttctttttat tcactactat tataactatt ccatctttat taatattatt aaaaatacaa      1320
     actaaactat aa                                                          1332
//

If you have problems or comments...

PBIL Back to PBIL home page