(data stored in SCRATCH3701 zone)

EMBL: AE017197.APRD

AE017197.APRD        Location/Qualifiers
FT   CDS_pept        complement(387489..389240)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="aprD"
FT                   /locus_tag="RT0305"
FT                   /product="alkaline proteinase secretion ATP-binding
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:RT0305"
FT                   /db_xref="EnsemblGenomes-Tr:AAU03785"
FT                   /db_xref="GOA:Q68X57"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR010128"
FT                   /db_xref="InterPro:IPR011527"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036640"
FT                   /db_xref="UniProtKB/TrEMBL:Q68X57"
FT                   /protein_id="AAU03785.1"
FT                   /translation="MDNKKNLNKKNPLVIALSECKTAFWIVFWFAFVINLLMLITPLYS
FT                   LQVLDRVLGSGNLQTLLFLSIIIAYIYFVYGLLQIARSFTLIKVGEWLDRTVAPVIFAS
FT                   SISATATRVNIGSSQLLRDFQAVKTFLTSTGINTLFDAPWSIIYIAVIFSIHPYIGFIT
FT                   IFGAIIIVSTAFFNAAATNKTLGEATEFSIKGMTQADIANRNAESIEAMGMMKNVTKNW
FT                   HKFNILALDKQSVASYRNGVISNFSRFVRNIMQMAVTGVGAYIVVKSHSADMTPGNMIM
FT                   SSIIVGRALAPFDNAIELWKSMSGAIKSYKNINNLFNTYSSRDEAMPIPNVNGHLTVEN
FT                   VYYAHPIPKHLSQPIVPKYILKGISFVVQPGEILAIIGPSATGKSTLAKIIVGVWKESS
FT                   GSVRLDSAEIYRWNREDFGKHVGYLPQGIELFSGSIKQNIARMEENADPQKVIEAAKIA
FT                   GAHEMILRFQDGYDTDIGPAGSNLSGGQRQRIGLARAFYGNPKLIILDEPNANLDEAGE
FT                   IALAMALKQAKLKGISVLVISHRPSVLSVVDKILILQDGSIAVYGTAEEIQKHLNTFKS
FT                   DTIHIKN"
     atggataata aaaaaaattt aaataaaaaa aatccgctag taatagcatt aagcgaatgt        60
     aaaacagcgt tttggatagt tttttggttt gcgtttgtca ttaatttact aatgttaatt       120
     actcctcttt attcactaca agttcttgat agagtacttg gaagcggtaa tctacaaaca       180
     ttattatttt tatctataat aatcgcatat atttactttg tttacggatt attacaaatt       240
     gctcgttctt ttacacttat aaaagtagga gaatggcttg atagaacagt cgctcctgta       300
     atttttgctt cttcaatttc tgcaactgca acacgtgtta acattgggtc tagtcaatta       360
     ttacgtgatt ttcaagctgt caaaacattc ctaacaagta ctgggattaa tactttattc       420
     gatgcaccgt ggagcattat ctatattgct gttatttttt caattcatcc atatattggt       480
     tttattacca tttttggcgc aattataata gtctcaaccg ccttctttaa tgctgcagca       540
     actaataaga cgctaggtga agctacagaa ttttcgataa aaggtatgac acaagcagat       600
     attgcaaaca gaaatgcaga atcaattgag gcaatgggga tgatgaagaa tgttacaaaa       660
     aattggcata aatttaatat attagcactt gataagcaat cagttgccag ctaccgtaac       720
     ggtgttattt ctaatttttc aagatttgtc cgcaatataa tgcaaatggc tgttaccgga       780
     gttggtgctt acattgtcgt aaaatctcac agtgcagata tgacaccagg taatatgatt       840
     atgagttcta taatagttgg tagagctctt gctccttttg ataatgctat tgaattatgg       900
     aaaagtatga gcggggcgat taaatcatac aaaaacatta ataatttatt taatacttac       960
     tcttctagag acgaagcaat gccaattccg aacgttaatg gacatcttac tgttgagaat      1020
     gtttattatg ctcaccctat accaaaacat ttatcacaac ctattgtacc aaaatatata      1080
     ttaaaaggta ttagttttgt agtacaacct ggtgaaattt tagcaattat cggtccttct      1140
     gctacaggaa aatcaacttt agctaaaatc atagttgggg tatggaaaga atcatcaggt      1200
     tccgtacgtt tagatagtgc tgaaatttat cgttggaata gagaggattt tggtaaacat      1260
     gtaggctatc ttcctcaagg aatagaactt tttagtggaa gtattaaaca aaatatagct      1320
     agaatggaag agaatgctga tccgcaaaaa gttattgaag ccgctaaaat agctggagca      1380
     catgaaatga tattaagatt ccaagacggt tatgatactg atatcggccc tgcaggctct      1440
     aatctatcag gaggacaaag acagcgtatt ggacttgcta gagcttttta cggtaatcca      1500
     aaattaataa ttttagatga acctaacgct aatttagatg aagcaggtga aattgcactt      1560
     gcaatggcct taaaacaagc aaaactgaaa ggaatatcag ttcttgtaat ttcacataga      1620
     ccatctgtat tatcagttgt tgataaaatt ctaatattac aggatggatc cattgcagtt      1680
     tatgggacag cagaagaaat tcaaaaacat ttaaacactt tcaaaagcga tacaattcat      1740
     attaagaact aa                                                          1752
//

If you have problems or comments...

PBIL Back to PBIL home page