(data stored in SCRATCH3701 zone)

EMBL: AE017197.CCMB

AE017197.CCMB        Location/Qualifiers
FT   CDS_pept        328031..328690
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ccmB"
FT                   /locus_tag="RT0259"
FT                   /product="heme exporter protein B"
FT                   /db_xref="EnsemblGenomes-Gn:RT0259"
FT                   /db_xref="EnsemblGenomes-Tr:AAU03740"
FT                   /db_xref="GOA:Q68XA2"
FT                   /db_xref="InterPro:IPR003544"
FT                   /db_xref="UniProtKB/TrEMBL:Q68XA2"
FT                   /protein_id="AAU03740.1"
FT                   /translation="MCLIMNNLFVLIKHEFILQHRINNIIKYIVIFFLFYIISTVLINS
FT                   ERDISKFGLIFSVICLLISLISFSTVIFKSDVEDGSLELLLSIVSCEKIIFAKFIAIFS
FT                   CTTVGLLFVLPIIYIFFDQILFDIALFFISVWMIFILSSSLVVLSGSMQCYFKKNTNFV
FT                   GTFIMPLLIPNIIMTGLILQDHNLQLIFIIIGINLIFLPVSFCLSAYLIKNIYNIT"
     atgtgtttaa ttatgaataa tttatttgta ctaattaaac atgaatttat attgcagcat        60
     cgcattaata atatcattaa atatatagtt atattttttc tattttacat aattagtact       120
     gttttaatta acagtgaaag ggatattagc aaatttggtt taattttttc ggtaatttgt       180
     ttattaattt cattaatcag tttttctact gtgatattta aatctgatgt agaagatgga       240
     agcttagagt tgttattatc aattgttagt tgtgaaaaaa ttatttttgc taaatttatt       300
     gctatattta gctgtactac agtaggtctt ctttttgttt taccaattat ttatattttt       360
     tttgatcaaa ttttgtttga tatagcactt ttctttatta gtgtgtggat gatattcatt       420
     ttatcaagta gtttagtagt attatcaggt agtatgcaat gttattttaa gaagaatact       480
     aattttgttg gtacatttat tatgccgtta ttaattccga atattataat gactggttta       540
     atattacaag atcataattt acaattaatt tttattataa taggaattaa tttgatattt       600
     ttacctgttt cgttttgctt aagtgcatat ttaattaaaa atatttacaa tattacatga       660
//

If you have problems or comments...

PBIL Back to PBIL home page