(data stored in SCRATCH3701 zone)

EMBL: AE017197.COQ7

AE017197.COQ7        Location/Qualifiers
FT   CDS_pept        228891..229427
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="coq7"
FT                   /locus_tag="RT0180"
FT                   /product="ubiquinone biosynthesis protein CoQ7"
FT                   /db_xref="EnsemblGenomes-Gn:RT0180"
FT                   /db_xref="EnsemblGenomes-Tr:AAU03664"
FT                   /db_xref="GOA:Q68XH8"
FT                   /db_xref="InterPro:IPR009078"
FT                   /db_xref="InterPro:IPR011566"
FT                   /db_xref="UniProtKB/TrEMBL:Q68XH8"
FT                   /protein_id="AAU03664.1"
FT                   /translation="MPRPDFSNLDKQIHDIIRVNHAGEYGAKRIYQGQLKYIKSQNDRM
FT                   LIKEMLDNEAVHLNFFEKKILERAVRPTVLLSFWHHYGFLLGALSSLIGIKTAMLVTES
FT                   IEEVIAKHYEQQINYLENRNVESELLNNLIKFRLEEIEHKNIAVIYSTNAIFADIISKI
FT                   VKIICHISILLSKKI"
     atgcctagac ctgatttttc taaccttgac aaacaaatac acgatataat tagagttaat        60
     catgctggag agtatggtgc aaaaagaatt tatcaaggac agctaaaata tatcaaatct       120
     caaaatgatc gtatgttgat taaagaaatg cttgataacg aagcagtgca tttaaatttt       180
     tttgaaaaaa aaatacttga aagagcagta agaccaacag ttttattatc tttttggcat       240
     cattatggat ttttacttgg tgctttatct tccttgatag gaataaaaac tgcaatgctt       300
     gttaccgaga gtatagaaga agtaatagca aaacattatg aacagcaaat aaattattta       360
     gaaaatagaa atgttgagtc agaattatta aataatctta ttaaatttcg acttgaagaa       420
     attgaacata aaaatattgc agtaatatat agcactaatg caatatttgc agatatcatt       480
     agtaaaatag tgaagataat ttgtcatatc tctatacttt taagtaagaa aatttag          537
//

If you have problems or comments...

PBIL Back to PBIL home page