(data stored in SCRATCH3701 zone)

EMBL: AE017197.CUTA

AE017197.CUTA        Location/Qualifiers
FT   CDS_pept        complement(211874..212323)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cutA"
FT                   /locus_tag="RT0168"
FT                   /product="probable periplasmic divalent cation tolerance
FT                   protein CutA"
FT                   /db_xref="EnsemblGenomes-Gn:RT0168"
FT                   /db_xref="EnsemblGenomes-Tr:AAU03652"
FT                   /db_xref="GOA:Q68XJ0"
FT                   /db_xref="InterPro:IPR004323"
FT                   /db_xref="InterPro:IPR011322"
FT                   /db_xref="InterPro:IPR015867"
FT                   /db_xref="InterPro:IPR022438"
FT                   /db_xref="UniProtKB/TrEMBL:Q68XJ0"
FT                   /protein_id="AAU03652.1"
FT                   /translation="MKHPDTKNNLQEINDSVSRAAVHTKMHGHPKTYKDNIANFLSSSS
FT                   IKDYCLILTTTNDLQIAEKIASILLELNLAACIQIDNIKSYYRWDNKTIIENEHRLVIK
FT                   TKSYNYNAIENKILEIHNYALPQIIKINIDYGYQQYLKWIDQNSK"
     atgaaacatc ctgatacaaa aaataacttg caagagatca atgactctgt aagcagagca        60
     gcagtacata caaaaatgca tggacatcca aagacttaca aagataacat agcgaatttt       120
     ttaagttcat cgagtataaa agattactgt ttaattttaa ctactactaa tgatttacaa       180
     attgccgaaa aaatagcatc tattttgtta gaattaaact tggcggcctg tattcaaatt       240
     gataatatca aaagttacta tagatgggat aataaaacaa ttatagaaaa tgaacatcgg       300
     cttgtcatta aaacaaaatc ttataattat aatgcaattg aaaataaaat tcttgaaatt       360
     cataattatg cattaccgca aataataaaa ataaatattg actatggtta ccaacaatac       420
     ttaaaatgga ttgaccaaaa tagtaaataa                                        450
//

If you have problems or comments...

PBIL Back to PBIL home page