(data stored in SCRATCH3701 zone)

EMBL: AE017197.DNAK

AE017197.DNAK        Location/Qualifiers
FT   CDS_pept        complement(222712..224595)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dnaK"
FT                   /locus_tag="RT0176"
FT                   /product="chaperone protein DnaK"
FT                   /db_xref="EnsemblGenomes-Gn:RT0176"
FT                   /db_xref="EnsemblGenomes-Tr:AAU03660"
FT                   /db_xref="GOA:Q68XI2"
FT                   /db_xref="InterPro:IPR012725"
FT                   /db_xref="InterPro:IPR013126"
FT                   /db_xref="InterPro:IPR018181"
FT                   /db_xref="InterPro:IPR029047"
FT                   /db_xref="InterPro:IPR029048"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q68XI2"
FT                   /protein_id="AAU03660.1"
FT                   /translation="MGKVIGIDLGTTNSCVAVMEGKEPKVIDNAEGERTTPSIIAFANS
FT                   ERLVGQPAKRQAVTNPRNTIYAVKRLIGRNFTDPMVRKDQGLVPYNIVKADNGDAWVEA
FT                   DNNKYSPSQISAFILQKMKETAENYLGEKVTQAVITVPAYFNDAQRQATKDAGKIAGLE
FT                   VLRIINEPTAAALAYGFEKSSSKTIAVYDLGGGTFDVSILEISDGVFEVKSTNGDTFLG
FT                   GEDFDTRILNHLIDVFKKDSGIDLSKDPLALQRLKEAAEKAKKELSSTSATDINLPYIT
FT                   ADSTGPKHLNIKFTRAELEKLVDDLIEKTIEPCRQALKDAGFKPTDIQEVVLVGGMTRM
FT                   PKVQEAVKKFFGREPHKGVNPDEVVALGAAIQGGVLNKEVTDILLLDVTPLSLGIETLG
FT                   GVFTRLIDRNTTIPSKKSQVFSTADDNQHAVTIRVFQGEREMAKDNKLLGQFNLEGIPP
FT                   APRGVPQIEVTFDIDANGIVHVSAKDKASGKEQKVTIQASGGLSDSEIEQMVKDAEHNA
FT                   DEDKKRKELIETKNAADSLVYSTEKTLREYGDKLSSEEKGAVEEALASLKSALESEDAS
FT                   LIKEKTNNLTAANMKIGETMYKAQTENQHSEANTVNDEKVVDADFQDVDKK"
     atgggaaaag taataggtat tgatcttggg actacaaact cttgtgttgc ggtaatggaa        60
     ggaaaagaac caaaagtaat agacaatgca gaaggtgaga gaacgacacc ctcaataatt       120
     gcctttgcta acagcgaaag acttgttgga caacctgcta aaagacaagc tgtcactaac       180
     cctcgaaaca ctatatatgc ggtaaaacga ttaataggta gaaattttac tgatccaatg       240
     gttagaaaag atcaaggttt agtaccatac aatatagtta aagccgataa cggtgatgca       300
     tgggttgaag cagataataa taaatattca cctagccaaa ttagcgcttt cattttacaa       360
     aaaatgaaag aaactgctga aaactattta ggtgaaaaag taacgcaagc agtaattact       420
     gtacctgctt attttaatga cgcacaacga caagcaacaa aggatgctgg taaaatagca       480
     ggtcttgagg tcttgagaat aattaatgaa ccaactgctg cagcacttgc ttatggtttt       540
     gaaaaatcat caagtaagac tattgcagta tatgatcttg gaggtggcac attcgatgtt       600
     tcaattctcg agatttctga cggtgttttt gaagtaaaat caacaaacgg tgatacattc       660
     cttggtggtg aagatttcga tacaagaata ttaaatcatc taatagatgt attcaaaaaa       720
     gacagtggta ttgatttaag caaagatcct ttagcattac aacgtttgaa agaagcagca       780
     gaaaaagcta agaaagagct atcttcaacg tcagctactg atattaattt accttatatt       840
     actgctgata gcacaggacc aaaacattta aatattaaat ttactagggc agaacttgaa       900
     aaattagtag atgatttaat tgaaaaaact attgaacctt gccgtcaagc tttaaaggat       960
     gcaggtttta agcctactga tattcaagaa gtagtattag taggcggtat gactagaatg      1020
     ccgaaagtac aagaagctgt aaaaaaattc tttggacgtg aaccacataa aggtgtcaat      1080
     cctgacgaag ttgtagcact tggtgcagct atccaaggag gtgtgttaaa taaagaagtg      1140
     acggatatat tattgttaga cgttacacct ttatcactcg gtattgaaac acttggtggt      1200
     gtatttacaa gattaattga tcgcaatacc actattccat caaaaaagag tcaagtattt      1260
     tcaacagctg acgataatca gcatgctgta actattagag tattccaagg tgaacgtgaa      1320
     atggcaaaag ataataagtt acttgggcaa tttaatctcg aaggtatacc acctgcacca      1380
     agaggggttc cacaaataga agtaacgttt gacattgatg ctaacgggat agttcatgtt      1440
     tcagctaaag ataaagcaag cggtaaagaa cagaaggtaa ctattcaagc ttccggtggt      1500
     cttagcgatt cagaaatcga acaaatggtg aaagatgcag agcataatgc cgatgaagat      1560
     aaaaagcgta aagaacttat tgaaacaaaa aatgctgctg atagtttagt ttattctact      1620
     gaaaagactt taagagagta tggggataaa ttatcatctg aagagaaagg agcggttgaa      1680
     gaagcactag cctctttaaa atcagcactt gagtcggaag atgcttcttt aattaaagaa      1740
     aagactaaca atttaacagc agctaacatg aaaatcggtg agacaatgta taaagcacaa      1800
     accgaaaatc agcattctga agcaaatact gttaacgatg aaaaagtagt agatgccgat      1860
     tttcaagatg tagataagaa atag                                             1884
//

If you have problems or comments...

PBIL Back to PBIL home page