(data stored in SCRATCH3701 zone)

EMBL: AE017197.ENGB

AE017197.ENGB        Location/Qualifiers
FT   CDS_pept        complement(48098..48742)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="engB"
FT                   /locus_tag="RT0035"
FT                   /product="probable GTP-binding protein EngB"
FT                   /db_xref="EnsemblGenomes-Gn:RT0035"
FT                   /db_xref="EnsemblGenomes-Tr:AAU03523"
FT                   /db_xref="GOA:Q68XW9"
FT                   /db_xref="InterPro:IPR006073"
FT                   /db_xref="InterPro:IPR019987"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR030393"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q68XW9"
FT                   /protein_id="AAU03523.1"
FT                   /translation="MINNGKALNNKKSSDYSKLFRHQAKFVAGANHINQIPDFSLPEIV
FT                   FVGKSNVGKSSIINTICNNKSLAKVSNIPGRTRQINFFNIIDKLIIVDLPGYGFANVPI
FT                   SVKEQWEVLITYYLRNSHNLMLVNLLIDSRRGIKENDKKVAELLLANKREFQIIFTKSD
FT                   KVTDRKNLNYEAQNFLATLHYSCNVIYVSSRSKEGTKELKASLAKCIKYQR"
     atgattaata atggaaaagc tctaaataat aaaaaatcaa gtgattatag taaacttttc        60
     cgtcatcaag ctaaatttgt agctggtgct aatcatataa atcaaatccc tgatttttca       120
     ttacctgaaa ttgtttttgt tggtaagtca aatgtcggta aatcaagcat aataaacacg       180
     atatgtaata ataaaagtct tgcaaaagtt tctaatattc caggacgtac taggcaaatc       240
     aatttcttta atattataga taaacttatt atcgttgacc ttccaggtta tggttttgct       300
     aatgttccta tatcagtcaa agaacagtgg gaagtgttaa ttacttatta tttacggaat       360
     agtcataatt taatgttagt taatttattg attgattcaa gaagaggtat aaaagaaaac       420
     gataagaagg tagctgagct attacttgca aataaaagag aatttcaaat tatttttact       480
     aaatccgata aagttacaga tcgtaaaaac cttaactacg aagcacagaa ttttcttgca       540
     actttacact actcatgtaa tgttatatat gtaagcagta ggagtaaaga aggtacaaaa       600
     gaacttaaag cgagtttggc aaaatgcatc aaatatcaaa gataa                       645
//

If you have problems or comments...

PBIL Back to PBIL home page