(data stored in SCRATCH3701 zone)

EMBL: AE017197.ENVZ

AE017197.ENVZ        Location/Qualifiers
FT   CDS_pept        complement(523930..525240)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="envZ"
FT                   /locus_tag="RT0412"
FT                   /product="osmolarity sensor protein EnvZ"
FT                   /EC_number="2.7.3.-"
FT                   /db_xref="EnsemblGenomes-Gn:RT0412"
FT                   /db_xref="EnsemblGenomes-Tr:AAU03889"
FT                   /db_xref="GOA:Q68WV3"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:Q68WV3"
FT                   /protein_id="AAU03889.1"
FT                   /translation="MAMHFISKLLPKTLFIRFMFIIIIPILIGQIVAIFLFYDRHWYNV
FT                   SYYTSTIIINEIESLIKEHKNNSRESTHLLENYLNLSYQFQFNKKLSIKQSKLSEPLTI
FT                   FKNILATKIYEKNIVKLNKENKIEVFLELKDGILYITFPAKLLLNPTVYIFVLWIISLT
FT                   IILLSVSIIFSKNQIKSILTLADSMDKFGRGILKSNNFKPSGALEIRNAGLAFLKMKAR
FT                   IEKQINKRTNMLAMISHDLRTPLTRMKLQLELMEENEAIKGFKQDILTMQQMINSYLDF
FT                   AKGESTEEFEEILLLPWIEHLLNKWPHINIEFIKSTNLNKLAVLMKPNSFERALSNLIG
FT                   NAIKYGTKIEISVKNNQSTVTIIIEDNGIGIDDMEKHLVFKPFYRSDKARQLDNSSNVG
FT                   LGLAITKEIINNHKGCIYLEDSKNLGGLLVRIEIPKI"
     atggctatgc actttatatc taaactatta ccgaaaacat tatttatacg gttcatgttt        60
     attatcatca ttccaatttt aataggacaa atagttgcta tatttttgtt ttacgatcgt       120
     cattggtata atgtttcata ttatactagt actattatta tcaatgaaat tgaatcactt       180
     attaaagagc ataaaaataa ttcaagagag agcacacatt tattagaaaa ttatcttaat       240
     ttatcttatc agtttcagtt taataaaaag ttatctataa aacagtctaa attaagtgaa       300
     cctttaacta tatttaaaaa tattttagct acaaagattt atgaaaaaaa tatagttaaa       360
     ctgaataagg aaaataaaat tgaagtattt ttagaattaa aagatggaat attatatatt       420
     acttttcctg caaaattatt acttaaccct acagtatata tatttgtttt atggattata       480
     tctttaacta ttatattact ttctgtttct attatttttt caaaaaatca aattaaatca       540
     atattaacac ttgctgatag tatggataaa tttggtcgag gtattttaaa aagcaacaat       600
     ttcaaacctt caggtgcttt agaaataaga aacgcaggac ttgctttttt aaaaatgaaa       660
     gctcgtattg aaaaacaaat taataaaaga actaatatgc ttgctatgat ctcacatgac       720
     cttagaactc ctttaacaag aatgaaatta caacttgaat tgatggaaga aaacgaagca       780
     atcaaaggat ttaaacaaga tatattaact atgcagcaaa tgataaattc ttatttagat       840
     tttgctaaag gcgaaagtac agaagaattt gaagaaattt tattattacc ttggattgag       900
     catcttttaa ataaatggcc tcatataaat attgaattta taaaatctac taatttaaat       960
     aaactagcag tactcatgaa accaaattct tttgaaagag cattgtctaa tttaatcggt      1020
     aacgctataa aatatgggac taaaattgaa atttctgtga aaaataatca atctaccgta      1080
     actataatta tagaagataa cggtatcggt atagatgata tggaaaaaca tcttgtattt      1140
     aaaccatttt atagatctga taaagcaaga caacttgata attcaagcaa tgtaggactt      1200
     ggacttgcta tcactaaaga aataataaat aatcataaag gttgtattta tttagaagat      1260
     agtaagaatt taggtggact attggtaaga atagaaatac ctaaaatata a               1311
//

If you have problems or comments...

PBIL Back to PBIL home page