(data stored in SCRATCH3701 zone)

EMBL: AE017197.FTSI2

AE017197.FTSI2       Location/Qualifiers
FT   CDS_pept        complement(718673..720358)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ftsI2"
FT                   /locus_tag="RT0555"
FT                   /product="cell division protein FtsI/ penicillin-binding
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:RT0555"
FT                   /db_xref="EnsemblGenomes-Tr:AAU04023"
FT                   /db_xref="GOA:Q68WG9"
FT                   /db_xref="InterPro:IPR001460"
FT                   /db_xref="InterPro:IPR005311"
FT                   /db_xref="InterPro:IPR012338"
FT                   /db_xref="InterPro:IPR036138"
FT                   /db_xref="UniProtKB/TrEMBL:Q68WG9"
FT                   /protein_id="AAU04023.1"
FT                   /translation="MKQILEKWKPAIKSLIIWNICSKNTKIRLLMVICGFSFLFSTVSY
FT                   RLIIVATNVYDKNINSFKKKHQFRKEIVDRNGNLLAMNLPSASLFANPQIVLDPETSVK
FT                   KLAEILPDINKAKLIKELKSNKSFIWVKRDLLPSQQEKIISLGLLGFEFEEEQKRIYIF
FT                   SNLLSHVIGYVGRDAVGLSGLELAYDKYLTNTDYELNDLKDQKAPLQLSIDIRLQSILS
FT                   EEIDKTLKKFNAIGAVGIIADPNNGEILALVNKPDFDPHYPSLAKPEELFNTASLGIYE
FT                   MGSVFKSLTMAVGFDTGVINMNDAYDISYMKVGGFQLKDYTPRQGWHSVPEIFLYSSNI
FT                   GTSQIMLEIGKNDFKKYLKKLGLLDQLQIELPERGTPLFPSEKRWNELTSVTMSYGYGI
FT                   SISPLHFVRAILPVVNGGTLYDLTLLKRKTQKVIGTKVFSENTSTQMKKLFRSVVKEGN
FT                   GKRAEIKGYLIGGKTGTAEKLSQGVGGKKKYLKNSRASSFLGILPASNPQYVIFIRFDE
FT                   PKPTKESFGFATASWTAVPTAGRVFERMISLYGLEPIEQNEEES"
     atgaagcaaa ttttagaaaa atggaagcct gcgattaaaa gtctaataat ttggaatatt        60
     tgtagtaaaa acacaaaaat tcgattatta atggttattt gtggtttttc ttttcttttt       120
     tctactgtat cttacagatt aataattgtt gctacgaatg tttacgataa aaatattaat       180
     tccttcaaaa aaaaacatca atttagaaaa gaaatagttg atagaaatgg taatttatta       240
     gcaatgaatc taccatctgc ctcattattt gctaatccac aaatagtact tgatcctgaa       300
     acttctgtaa aaaagctagc agaaatctta cctgatatta ataaagctaa attaattaaa       360
     gaacttaagt caaataaaag ctttatatgg gtcaaaagag atttattacc tagtcagcaa       420
     gaaaagataa ttagccttgg gttacttggc tttgagtttg aagaagagca gaaacgaatt       480
     tatatctttt caaatttatt gtcacatgtt attggttatg taggtagaga tgcagtagga       540
     ctgagtggct tagaactcgc gtatgataaa tatttaacta atactgatta tgaattaaat       600
     gacctaaagg atcagaaagc accactccaa ttatctattg atattagatt acaaagtatt       660
     ttaagtgaag agatcgataa aacgttaaag aaatttaatg caataggagc agtaggaatt       720
     attgctgatc ctaataacgg tgagattctt gcattagtaa ataagcctga ttttgatcct       780
     cattatccaa gtttagcaaa accggaagag ctatttaata cggcaagtct cggtatttat       840
     gaaatgggtt cggtgtttaa atcattgact atggcggttg gttttgatac tggtgtaatc       900
     aatatgaatg atgcttatga tataagctat atgaaagtag gaggattcca gcttaaggat       960
     tataccccac ggcaagggtg gcatagcgta cctgagattt ttttatattc ttcaaatatt      1020
     ggtacaagtc aaatcatgct tgaaatcggt aaaaatgatt ttaaaaaata cctaaagaaa      1080
     ttagggttat tagatcagtt acaaatagaa ttacctgaac gaggcacacc attatttcct      1140
     tcagaaaaaa gatggaatga actaactagt gttactatgt cttatggcta tggtatttca      1200
     attagccctt tacattttgt aagagcgatt ttaccagttg ttaatggtgg cactttatat      1260
     gatcttactt tattaaaaag aaagactcaa aaagtaatcg gtacaaaagt ttttagtgaa      1320
     aatacctcta cccaaatgaa gaaattgttt agatcagtag tgaaagaagg taacggtaaa      1380
     cgagcagaga ttaaaggata tcttatcggt ggcaagactg gtacagcaga aaaactttca      1440
     caaggtgtag gaggtaaaaa gaaatatctt aaaaatagta gagcttcgtc atttttaggt      1500
     atacttcctg catctaatcc gcaatatgtt atttttatta gatttgatga gccaaaacca      1560
     actaaagaaa gctttggctt tgcaacagca agctggactg ctgtaccgac tgctggtaga      1620
     gtttttgaac gtatgatatc tttatatggt ttggaaccga tagaacaaaa tgaggaagag      1680
     agttaa                                                                 1686
//

If you have problems or comments...

PBIL Back to PBIL home page