(data stored in SCRATCH3701 zone)

EMBL: AE017197.FTSQ

AE017197.FTSQ        Location/Qualifiers
FT   CDS_pept        305341..306141
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ftsQ"
FT                   /locus_tag="RT0242"
FT                   /product="cell division protein FtsQ"
FT                   /db_xref="EnsemblGenomes-Gn:RT0242"
FT                   /db_xref="EnsemblGenomes-Tr:AAU03723"
FT                   /db_xref="GOA:Q68XB9"
FT                   /db_xref="InterPro:IPR005548"
FT                   /db_xref="InterPro:IPR013685"
FT                   /db_xref="InterPro:IPR026579"
FT                   /db_xref="InterPro:IPR034746"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q68XB9"
FT                   /protein_id="AAU03723.1"
FT                   /translation="MRQKTSSNKKKQKNTNNISLRRKLGLMYKKAILGLKIVLMIFVCL
FT                   FVFTKYFTSIKTYLITNIYQITTKLGFRLENVIIEGQQNVDELTILKVLNANKRSSIFA
FT                   LKLDEISNNLKKSKWIKEVYVSRRLPNTVYIKLFEREPIAIWQINNQLFLVDEEGYKIS
FT                   KDIQPFSHLLHVVGEGANIYASQLVLELKKYPALLNKTLVAIRVGDRRWDLNLKGNISI
FT                   KLPEKEFEAALKYIDALNKNNRLFNQNYKALDLRDRNKYYIQKY"
     atgagacaaa aaacaagctc aaataaaaaa aaacaaaaaa atactaataa tatttcatta        60
     cgcagaaaat tgggcttaat gtacaaaaaa gcaatattag ggcttaagat tgttttaatg       120
     atctttgtat gtctatttgt ttttaccaaa tattttacta gcataaaaac atacctaata       180
     acaaatatat atcaaattac aacaaaactt ggatttagac ttgagaatgt gattattgaa       240
     gggcagcaaa atgttgatga gcttacaata ttaaaggttt taaatgcgaa taagcgcagt       300
     tctatttttg ctcttaaatt agatgaaatt agcaataatt taaagaaaag taaatggatt       360
     aaggaagtat atgtaagtag aagattacca aatacagtat atataaaatt atttgaacga       420
     gaacctattg ctatttggca aattaataat caacttttcc tagttgatga agaaggttac       480
     aaaattagta aagatatcca acctttttct cacttattac atgttgtagg tgaaggtgcg       540
     aacatctatg caagtcaatt agtattagag ctgaagaaat atcctgcatt actaaataaa       600
     actttagttg ctataagagt tggagataga agatgggatt taaatcttaa agggaatata       660
     agtataaaat tacctgaaaa agaatttgaa gcagcattaa agtatatcga tgcactcaat       720
     aagaataata ggctttttaa tcaaaattat aaggctttgg atttaagaga tagaaataaa       780
     tattatatac agaaatattg a                                                 801
//

If you have problems or comments...

PBIL Back to PBIL home page