(data stored in SCRATCH3701 zone)

EMBL: AE017197.FTSW

AE017197.FTSW        Location/Qualifiers
FT   CDS_pept        503293..504426
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ftsW"
FT                   /locus_tag="RT0397"
FT                   /product="cell division protein FtsW"
FT                   /db_xref="EnsemblGenomes-Gn:RT0397"
FT                   /db_xref="EnsemblGenomes-Tr:AAU03874"
FT                   /db_xref="GOA:Q68WW8"
FT                   /db_xref="InterPro:IPR001182"
FT                   /db_xref="InterPro:IPR013437"
FT                   /db_xref="UniProtKB/TrEMBL:Q68WW8"
FT                   /protein_id="AAU03874.1"
FT                   /translation="MNNEISNNFIKLWWRSTDRQIIISLIILFAFSLMLVTTSGSIVAS
FT                   RIGLEESYFASRQIFYLAVASGLILLLSCLNKKWLRRFAILGFIMSVVLLIAVKFFGYE
FT                   VKGAVRWINILGLSIQPSEFIKPFFEVVTGWILALKFNDDFPSFTICVIFYFIVAILLI
FT                   IQPDFGMLVMITAVFGIQLFIAGMPIFWIMLAVFLGMLGVTIAYFWLPHVTQRINSFLD
FT                   PESSENYQVSKSLKAFEHGGLYGCGPGEGVVKQVLPDSHTDFIFAVAGEEFGAIICLIV
FT                   IAIFAFIVLSSFIKLLNETDKFVQFAASGIIAQLGLQAIINIGVTLHLLPTKGMTLPFI
FT                   SYGGSSTIAIAIATGMLLGFTRHRTPLNSYKICNIEI"
     atgaacaatg aaatatctaa taactttata aaattatggt ggcgtagtac cgataggcaa        60
     ataataattt ctttaattat tttatttgct tttagtctca tgcttgttac tacttcaggt       120
     tcaatagtag caagtagaat agggcttgaa gaaagttatt ttgcttctag acaaatattt       180
     tatttagctg ttgcttcagg attaatatta ttattgtcat gtcttaataa aaaatggtta       240
     aggcgttttg caatattggg atttattatg agtgttgttt tattaatagc agtgaagttt       300
     tttggatatg aagtaaaagg tgcagtgcga tggattaata ttttaggtct ttctattcag       360
     ccttcagaat ttatcaaacc attttttgaa gttgttactg gatggatatt agcgctaaaa       420
     tttaatgatg attttccaag ttttacaatt tgtgtaatat tttattttat tgttgctatt       480
     cttttaatta ttcagccgga tttcggaatg cttgtaatga ttacagcagt gttcggtatt       540
     cagcttttta ttgcaggtat gccaatattt tggattatgc tagctgtttt tttaggaatg       600
     ttaggagtaa ctattgcgta tttttggtta cctcatgtaa cgcaacgaat taattcattc       660
     ttagatcctg aaagtagtga gaattatcaa gtgagtaaat ctcttaaggc ttttgagcat       720
     ggaggtttat atggatgtgg tccaggggag ggtgtagtaa aacaggtact tcctgactcg       780
     catacggatt ttatttttgc tgtagcaggt gaagagtttg gagctattat ttgccttatt       840
     gttatcgcta tatttgcttt tatagtatta agcagtttta ttaaattatt aaacgaaaca       900
     gataaatttg tacaattcgc tgctagtggt ataattgcac aattaggact gcaagcaata       960
     attaatattg gtgtaacttt acatttacta cctactaaag gtatgacatt accatttatt      1020
     agttatggtg gttcttcaac aattgcaata gctatcgcaa ctggtatgct tcttggattt      1080
     acgaggcacc gaaccccttt aaattcatat aaaatttgta atattgaaat atga            1134
//

If you have problems or comments...

PBIL Back to PBIL home page