(data stored in SCRATCH3701 zone)

EMBL: AE017197.GIDA

AE017197.GIDA        Location/Qualifiers
FT   CDS_pept        complement(97489..99354)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gidA"
FT                   /locus_tag="RT0076"
FT                   /product="glucose inhibited division protein A"
FT                   /db_xref="EnsemblGenomes-Gn:RT0076"
FT                   /db_xref="EnsemblGenomes-Tr:AAU03562"
FT                   /db_xref="GOA:Q68XT0"
FT                   /db_xref="InterPro:IPR002218"
FT                   /db_xref="InterPro:IPR004416"
FT                   /db_xref="InterPro:IPR020595"
FT                   /db_xref="InterPro:IPR026904"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q68XT0"
FT                   /protein_id="AAU03562.1"
FT                   /translation="MLKYGVIIIGGGHAGVEAAAASARLGVHTLLITLKPENLGEMSCN
FT                   PAIGGIAKGTLVKEIDALDGLMGFVIDKAGIHYKMLNETRGPAVWGPRAQADRKLYKKV
FT                   MYQILTNYRNLDILYGKVEDIQIKSSKVEAVILNNGIKIFCQKVVLTTGTFLSGFIHIG
FT                   SMKIPAGRIYEEPSYGLSNTLKRLGFKIARLKTGTPPRIDGRTIDYSKTTLQQGDQIPR
FT                   PFSELTDAIDVPQINCFITKTTAETHDIIRENLDKSAMYSGQIKGIGPRYCPSIEDKIV
FT                   KFSTKLEHRIFLEPEGLEDYTIYPNGISTSLPKEIQYKLIKTIPGLENAQVLRPGYAIE
FT                   YDYVDPREINITLETKKITGLYFAGQINGTTGYEEAAGQGIIAGINAALSVKDQEPFIL
FT                   TRATSYIGVMIDDLTTSGTVEPYRMFTSRSEYRLSLRADNADLRLTELGINIGVVTEKR
FT                   KNIFTKKCNNIEKTKLLLNKLSLTTSKLAKIGIQVAQDGKYKTVLDLFKIPTFNVEQAI
FT                   KIFPILRKQNNNILQLLYIEAKYASYLTRQYADINLFQSEEIQLIPKNIDYFKIPSISL
FT                   EIQEKLSYHKPTTIGVARRISGITPAAIMAIIIYLKTKYSDGSSK"
     atgctaaaat atggtgtaat aattataggt ggtggacatg caggtgtaga agcagcagct        60
     gcttctgcgc gtcttggagt acatactctc ttaattacac taaaaccaga aaatttaggt       120
     gaaatgtctt gtaatccagc aattggtgga attgcaaagg gcacattagt taaagaaatc       180
     gatgcacttg atgggttaat gggcttcgtt atagacaaag ctggtataca ttataaaatg       240
     ctgaatgaga ctagaggacc agcagtttgg gggcctagag ctcaagctga tcggaagctt       300
     tataaaaaag tgatgtatca aatattaaca aattaccgta atttagatat attatatggt       360
     aaagtagaag atatacaaat taaatcttct aaagttgaag cggttatttt aaataatggt       420
     attaaaatat tttgtcaaaa agttgtatta actactggta cttttttatc tggttttatt       480
     catataggtt caatgaaaat tcctgctggt agaatatatg aagaaccttc gtatggatta       540
     tcaaatacat taaaaagact aggatttaag attgctcgtt taaaaacagg cacaccacca       600
     agaattgacg ggcgtactat tgattatagt aaaactactt tacaacaagg agatcaaatc       660
     cctcgccctt tttctgaatt aacagatgct attgatgttc ctcagataaa ttgctttatc       720
     acaaaaacaa ctgcagaaac tcatgatatt attcgtgaaa atcttgataa atctgcaatg       780
     tattcagggc aaataaaagg gataggacca cgatattgtc cttctattga agataaaata       840
     gtcaaattta gtacaaaatt agaacatcgt atatttttag aacctgaggg attagaggat       900
     tatacgattt atccaaatgg tatttctact tctttgccta aagagataca atacaaatta       960
     atcaaaacaa taccgggatt agaaaatgca caagttttgc gtccaggtta tgctatagaa      1020
     tatgattatg ttgatccacg tgaaataaat attactctag agacaaaaaa aataactggc      1080
     ttgtatttcg ctggacaaat taatggtact acaggatatg aggaagctgc tggacaaggt      1140
     ataatagctg gtataaatgc tgctttatca gtaaaagatc aagagccctt tatcttaaca      1200
     agagcaacaa gttatattgg agtaatgatt gatgatttaa caacatccgg tactgtagaa      1260
     ccttatcgta tgtttacttc tcgttcagaa tatagattat ctttaagagc agataatgct      1320
     gatttacgtt taactgaatt agggataaac attggagtag taacagagaa gcgaaaaaat      1380
     atttttacaa aaaaatgtaa caatatagaa aaaacaaaat tattgttaaa taaattgtct      1440
     ttaactacca gtaaacttgc gaaaattggt atacaagttg cacaggacgg taaatataaa      1500
     acagtattag atttatttaa aatacctact tttaatgttg agcaagctat taaaattttt      1560
     cctattctta ggaaacaaaa taataatatt ttacaattac tttatattga agcaaaatat      1620
     gcttcatatt taactagaca atacgcagat attaatttat tccaaagtga agaaatacag      1680
     ttaataccta aaaatattga ctattttaaa atacctagta tatcattaga aatacaggaa      1740
     aaactttctt atcataaacc gactactatt ggtgtagcac gtcgcatttc agggattaca      1800
     cctgcagcaa ttatggctat tataatttat ttaaaaacta aatatagcga tggaagttcc      1860
     aagtga                                                                 1866
//

If you have problems or comments...

PBIL Back to PBIL home page