(data stored in SCRATCH3701 zone)

EMBL: AE017197.HSLV

AE017197.HSLV        Location/Qualifiers
FT   CDS_pept        391377..391925
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hslV"
FT                   /locus_tag="RT0309"
FT                   /product="heat shock protein ATP dependent protease HslV"
FT                   /db_xref="EnsemblGenomes-Gn:RT0309"
FT                   /db_xref="EnsemblGenomes-Tr:AAU03789"
FT                   /db_xref="GOA:Q68X53"
FT                   /db_xref="InterPro:IPR001353"
FT                   /db_xref="InterPro:IPR022281"
FT                   /db_xref="InterPro:IPR023333"
FT                   /db_xref="InterPro:IPR029055"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q68X53"
FT                   /protein_id="AAU03789.1"
FT                   /translation="MSDNLALHGTTILCLKKNEEIIIAADGQVSHGNTVLKSTARKLRT
FT                   IANNKIIVGFAGSTADGLALFEKLEIKIEQYNSNLLRSAVELAKDWRNDKYLRRLEAMM
FT                   IVADRSHILILTGNGDVIEPENNIAAIGSGGLFALSAARALMSYENNLTAEEIALKSMN
FT                   IAADLCVFSNHNIIMEKVV"
     atgtcagata atttagcctt acacggcaca acaatacttt gtttaaaaaa gaatgaagaa        60
     ataattatag cagcagatgg acaagtatct catggtaata ccgtactcaa atctacagca       120
     cgaaaactgc gtactatagc aaataacaaa attattgtcg gttttgcagg ttctactgct       180
     gatggtcttg cattatttga aaaacttgaa ataaaaatag agcaatataa ttcgaattta       240
     cttagaagtg cagttgaact tgcaaaagat tggcgtaacg ataaatattt gagacgttta       300
     gaagcaatga tgattgttgc cgatcgtagt catatattaa ttttaaccgg taacggtgat       360
     gtaatagagc ctgaaaataa tattgcagca ataggatcag gtggtttatt cgcactttct       420
     gcagctcgtg ctttaatgtc ttatgagaat aatctcactg ctgaggaaat tgctttaaaa       480
     tctatgaata tagctgcaga tttgtgtgta ttttctaatc ataatattat aatggaaaaa       540
     gttgtatga                                                               549
//

If you have problems or comments...

PBIL Back to PBIL home page