(data stored in SCRATCH3701 zone)

EMBL: AE017197.HUPA

AE017197.HUPA        Location/Qualifiers
FT   CDS_pept        202937..203236
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hupA"
FT                   /locus_tag="RT0162"
FT                   /product="DNA-binding protein HU"
FT                   /db_xref="EnsemblGenomes-Gn:RT0162"
FT                   /db_xref="EnsemblGenomes-Tr:AAU03646"
FT                   /db_xref="GOA:Q68XJ6"
FT                   /db_xref="InterPro:IPR000119"
FT                   /db_xref="InterPro:IPR010992"
FT                   /db_xref="InterPro:IPR020816"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q68XJ6"
FT                   /protein_id="AAU03646.1"
FT                   /translation="MNKTEFIAYMTEHCHNNKHAAHKTLTKADAEKALNLVIDSVISAI
FT                   KSKHNVNLTGFGSFEIHHRKAREGRNPKTGAKMTIDAYNQPTFRAGRKLKEACN"
     atgaataaaa ccgaatttat agcatatatg actgaacatt gtcataataa taagcatgct        60
     gcacataaaa cattaacaaa agctgatgcc gagaaagcac ttaatttagt tattgatagt       120
     gtgattagtg caataaagag caagcataat gttaatctta caggttttgg ttcattcgaa       180
     atacatcata gaaaagcacg tgaagggcgt aatccaaaaa ctggagcaaa aatgacaata       240
     gatgcttaca atcaacctac ttttagagct ggaagaaaat tgaaagaagc atgtaattaa       300
//

If you have problems or comments...

PBIL Back to PBIL home page