(data stored in SCRATCH3701 zone)

EMBL: AE017197.IHFB

AE017197.IHFB        Location/Qualifiers
FT   CDS_pept        complement(651272..651514)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ihfB"
FT                   /locus_tag="RT0511"
FT                   /product="integration host factor beta subunit"
FT                   /db_xref="EnsemblGenomes-Gn:RT0511"
FT                   /db_xref="EnsemblGenomes-Tr:AAU03980"
FT                   /db_xref="GOA:Q68WL2"
FT                   /db_xref="InterPro:IPR000119"
FT                   /db_xref="InterPro:IPR010992"
FT                   /db_xref="UniProtKB/TrEMBL:Q68WL2"
FT                   /protein_id="AAU03980.1"
FT                   /translation="MATKNYLIDKVHDKLNYLSKQDVKESVDLILDYLNESLKEQKRIE
FT                   IRNFGNFSIRKRKFPESNKFYNTVYYRMPKNLFKD"
     atggctacta agaattattt aatagataaa gtacatgata aactgaatta tctttctaaa        60
     caagatgtta aagaatcagt agatttaatt ttagattatt taaatgaatc gcttaaagaa       120
     caaaagcgta ttgaaatcag gaatttcggt aatttctcta tacgtaaacg taaatttcct       180
     gaaagtaata aattctataa tactgtttat tacagaatgc cgaaaaattt atttaaggat       240
     taa                                                                     243
//

If you have problems or comments...

PBIL Back to PBIL home page