(data stored in SCRATCH3701 zone)

EMBL: AE017197.ISCS1

AE017197.ISCS1       Location/Qualifiers
FT   CDS_pept        complement(603542..604774)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="iscS1"
FT                   /locus_tag="RT0473"
FT                   /product="cysteine desulfurase protein IscS/NifS"
FT                   /EC_number="4.4.1.-"
FT                   /db_xref="EnsemblGenomes-Gn:RT0473"
FT                   /db_xref="EnsemblGenomes-Tr:AAU03946"
FT                   /db_xref="GOA:Q68WP6"
FT                   /db_xref="InterPro:IPR000192"
FT                   /db_xref="InterPro:IPR010240"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="InterPro:IPR016454"
FT                   /db_xref="InterPro:IPR020578"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q68WP6"
FT                   /protein_id="AAU03946.1"
FT                   /translation="MNQQLKNLTLPIYMDYQSTTPIDPRVMEAMLPYFTTKFGNPHSRS
FT                   HSFGWEAENAVENARSMIAKLIGADSKEIIFTSGATESNNLVIKGIAKFYGNKKNHIIT
FT                   LVSEHKCVLNACRYLEQEGIKITYLPIKPNGIIDLEILKNAITDQTLLVSVMAVNNEIG
FT                   VIQPLREIGKICRERSVFFHSDIAQGFGKIPINVNEYNIDLASISGHKIYGPKGIGALY
FT                   IRKKPRVRVTPLINGGGQERGMRSGTLPTPLIVGFGIAAEISYNEMEKDAQHVNYLFDR
FT                   FLNNIYSRIPEVYLNGDKDQRYKGNLNLSFAGVEGESIILAIKDLAVSSGSACTSASLE
FT                   PSYVLRSIGISEELAHTSIRFGIGRFTTEQEIDYAVNLICSKIDKLRKLSPLWEMMQEG
FT                   IDLKKIKWTAH"
     atgaatcaac aattaaaaaa tttaacttta ccaatatata tggattatca gtctactact        60
     ccaatagatc caagggtaat ggaagcaatg ttgccatatt ttactactaa attcggtaat       120
     cctcattcac gaagtcactc ttttggttgg gaagcagaaa atgctgttga aaatgcacgg       180
     agtatgatag caaagttaat aggggcggat agtaaagaaa ttatttttac ttctggtgca       240
     accgaatcta ataaccttgt aataaaggga atagcaaaat tttacggtaa taaaaaaaat       300
     catattatca ccttagtaag tgaacataaa tgtgtactta acgcttgtag gtatttagag       360
     caagaaggta tcaaaatcac atacttaccg attaaaccga atggaataat agatttagaa       420
     attctcaaaa atgcaattac tgatcagact ttgttagtgt cagttatggc tgttaataat       480
     gaaataggtg ttattcaacc tttacgggaa attggaaaaa tttgtcgtga aagaagtgtg       540
     ttttttcatt ccgatattgc tcaaggattc ggtaaaattc caattaatgt taacgagtat       600
     aatattgatc ttgcaagtat ttcaggacat aaaatttatg gtccaaaagg aataggtgca       660
     ttatatataa gaaaaaaacc tcgtgtgcgt gttacaccac taataaatgg tggtggacaa       720
     gagagaggaa tgcgttcagg tactttacct actcctttaa tcgtaggttt tggcatagct       780
     gctgaaatat catataatga aatggaaaaa gatgctcagc atgtcaatta cttatttgat       840
     agatttttaa ataatatata tagtagaatt ccagaagttt atttaaacgg tgataaagat       900
     caaagatata aaggtaatct aaatctcagc tttgctggag tagaaggtga gtcaattatt       960
     cttgctatta aagatttagc tgtttcttct ggttctgcgt gtacttctgc ttccttagaa      1020
     ccatcatatg ttttacggtc cataggtatc agtgaagaac ttgcacatac ttcaattagg      1080
     tttggcatag gtagattcac tactgagcag gaaattgatt acgcagtaaa tttaatatgt      1140
     tcaaaaattg acaagttaag gaaattaagc cctctttggg aaatgatgca agaaggaatc      1200
     gatttaaaga agattaagtg gacagcacat tga                                   1233
//

If you have problems or comments...

PBIL Back to PBIL home page