(data stored in SCRATCH3701 zone)

EMBL: AE017197.ISCS2

AE017197.ISCS2       Location/Qualifiers
FT   CDS_pept        complement(604841..605977)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="iscS2"
FT                   /locus_tag="RT0474"
FT                   /product="cysteine desulfurase protein IscS/NifS"
FT                   /EC_number="4.4.1.-"
FT                   /db_xref="EnsemblGenomes-Gn:RT0474"
FT                   /db_xref="EnsemblGenomes-Tr:AAU03947"
FT                   /db_xref="GOA:Q68WP5"
FT                   /db_xref="InterPro:IPR000192"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="InterPro:IPR016454"
FT                   /db_xref="InterPro:IPR020578"
FT                   /db_xref="UniProtKB/TrEMBL:Q68WP5"
FT                   /protein_id="AAU03947.1"
FT                   /translation="MIYLDHNATTFIDPRVKEYIISLMDKELNPSSTHMAGRFAQNIIE
FT                   TARSQIATSLGITMLSGEYNITFTSSGTESNNLIMKNFYDGDIFISAIEHLSIYNHINY
FT                   APNIKVIRVNKQGLVDLEHLEDLLFQSNARKKLVSVMIANNENGVLQDIAAISKITKKY
FT                   DAKFHSDLVQSFGKISLNIKELGLDFATISGHKIGGGHGCGALISNSNFQLIPIIIGGG
FT                   QEKSVRSGTENVLAIAGFGLAAEFRRKNVSENYIKIRDLQERLEQKLKKYSNVNIISNN
FT                   VARLANTTLITVDNTDAQVKLIEFDLRNICVSSGSACSSGKISKSHVLTNMGIREEEAK
FT                   SSIRISLSHTNTVSDIKAFIKAFEEIYEYKPSSNHGIK"
     atgatatatc ttgatcataa tgcgactact ttcatcgatc cgagagttaa ggaatatata        60
     ataagtttaa tggataagga acttaaccct tcatctacgc atatggctgg cagatttgct       120
     cagaacatta tagaaacggc acgttcacaa atagcaacat ctcttggtat aacaatgtta       180
     tctggagaat ataatattac ttttacatct tctggaactg aaagtaataa tttaataatg       240
     aaaaattttt atgatggtga tatttttatt tcagctattg aacatttatc gatttataat       300
     catataaatt atgctccaaa tattaaagtt ataagagtta ataagcaagg actagttgat       360
     ttagaacatc tagaagactt attatttcaa agtaatgcta gaaaaaaatt agtttctgta       420
     atgatcgcaa ataatgaaaa tggagtttta caagatatag ctgcgataag taaaataact       480
     aaaaaatatg atgcaaaatt tcatagtgat ttagtacaga gttttggtaa aatatcttta       540
     aatattaaag aattagggtt agattttgct acaatttcag gacataaaat aggaggaggg       600
     catggttgtg gtgctttaat ttctaactct aattttcagc ttataccaat aattatagga       660
     ggaggccaag aaaaatcagt acgctcaggt actgaaaatg ttttagcaat tgccggcttt       720
     ggtttagctg ctgaatttag aagaaaaaat gtttcagaga attacataaa aatcagggat       780
     ttgcaagaaa gattagagca aaaactaaaa aaatattcaa acgtaaatat tattagtaat       840
     aacgtagcta ggttagctaa tactacctta attactgtcg acaatactga tgcacaagta       900
     aaattaatag agttcgattt acgtaatatt tgtgtaagtt ctgggtctgc ttgctcatca       960
     ggcaaaatat ctaaatcgca tgtattaacc aatatgggca taagagaaga agaagctaag      1020
     tcttcaattc gtatatcttt aagtcatact aatacagtaa gtgatataaa ggcttttata      1080
     aaagcttttg aggagatata tgaatataaa ccgtctagta accacggtat caagtaa         1137
//

If you have problems or comments...

PBIL Back to PBIL home page