(data stored in SCRATCH3701 zone)

EMBL: AE017197.ISPA

AE017197.ISPA        Location/Qualifiers
FT   CDS_pept        complement(481999..482541)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ispA"
FT                   /locus_tag="RT0380"
FT                   /product="intracellular septation protein A"
FT                   /db_xref="EnsemblGenomes-Gn:RT0380"
FT                   /db_xref="EnsemblGenomes-Tr:AAU03857"
FT                   /db_xref="GOA:Q68WY5"
FT                   /db_xref="InterPro:IPR006008"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q68WY5"
FT                   /protein_id="AAU03857.1"
FT                   /translation="MLKLLSEIGPVIAFFAGFFYGGGIQSATLYMLITSIICITLCYII
FT                   DKKVSKLSIISSTVLFVSGIITLISGDSMYIKIKPTILYVIFGIIFLMSGIRKNPFIKY
FT                   ALESIVRLKEESWIILSYRTAAFFFFMAVVNEVVWRNFSDETWVKFKVFGVIPITFIFI
FT                   LLQLPLLLKNKLPDSKI"
     atgttaaaac ttttatcaga aattggtcca gtaatagcat tttttgcagg ttttttttat        60
     ggaggcggta tacaaagcgc taccctttat atgcttatta catctattat ttgtattacc       120
     ctttgttata ttatagataa aaaagtctct aagctttcta ttatttcttc gactgtttta       180
     ttcgtttcgg gaatcattac tttaattagt ggcgattcaa tgtatataaa aatcaaacct       240
     actatattat atgttatttt tggaataata tttctcatga gtggtataag gaaaaatcct       300
     tttatcaaat atgctttaga gagcatagta cgtcttaaag aagaaagttg gataatttta       360
     agctatagaa cagctgcttt tttctttttt atggcggtag taaatgaagt agtttggcgt       420
     aatttctcag atgaaacatg ggtgaaattt aaagtattcg gtgtaatacc tatcactttt       480
     atatttattt tactgcaatt acctctttta ttaaagaata agttaccaga tagtaagata       540
     tga                                                                     543
//

If you have problems or comments...

PBIL Back to PBIL home page