(data stored in SCRATCH3701 zone)

EMBL: AE017197.LEPA

AE017197.LEPA        Location/Qualifiers
FT   CDS_pept        334763..336565
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="lepA"
FT                   /locus_tag="RT0266"
FT                   /product="GTP-binding protein LepA"
FT                   /db_xref="EnsemblGenomes-Gn:RT0266"
FT                   /db_xref="EnsemblGenomes-Tr:AAU03747"
FT                   /db_xref="GOA:Q68X95"
FT                   /db_xref="InterPro:IPR000640"
FT                   /db_xref="InterPro:IPR000795"
FT                   /db_xref="InterPro:IPR004161"
FT                   /db_xref="InterPro:IPR005225"
FT                   /db_xref="InterPro:IPR006297"
FT                   /db_xref="InterPro:IPR013842"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR031157"
FT                   /db_xref="InterPro:IPR035647"
FT                   /db_xref="InterPro:IPR035654"
FT                   /db_xref="InterPro:IPR038363"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q68X95"
FT                   /protein_id="AAU03747.1"
FT                   /translation="MNNQKYIRNFSIIAHIDHGKSTLADRLIEHCGGLNAREMSQQVLD
FT                   SMDIEKERGITIKAQTVRLVYKAKNGNTYYLNLMDTPGHVDFSYEVSRSLAACEGSLLV
FT                   VDSTQGVEAQTLANVYQAIANDHEIVPVLNKIDLAASEPEHVKKQIEDIIGIDASEAVL
FT                   ISAKNGIGIDSVLEAIINKLPSPKESSTDTLKALLVDSWYDPYLGVVILVRIIDGTLRK
FT                   NMRVKMIGTNSVYTVEHVGFFTPKKHISDVLYAGEIGFFTASIKRVSDCKVGDTITDEK
FT                   KSCEQALPGFKPNIPVVFCGFYPTDSAEFEHLKDSLAKLRLNDASFEYEMESSSALGVG
FT                   FRCGFLGLLHLEIIQERLSREFNLDLITTAPSVIYKIYMLDGESLEIHNPADLPDLQKI
FT                   ASMEEPWIKATIMVPDEFIGTVLSLCKEKRGIQLDHSYISNRAKIVYKLPLNEIVYDFY
FT                   DRLKSCSKGYASFEWQMDVYELSDLVNLRILVNGEVVDALSTIVHRSRAEQRGRALCVR
FT                   LKDLIPRQQIDIAIQASVGNRIIARETIKALRKDVLSKCYGGDISRKRKLLEKQKAGKK
FT                   KMRQYGNIEIPQSAFIAALQIGGE"
     atgaataatc aaaaatatat aaggaatttc tcaataattg ctcatataga tcacggtaaa        60
     tctacgttag ctgataggtt aatcgagcat tgtggaggtt tgaatgctag ggaaatgagt       120
     cagcaagtgt tagattcgat ggatatagag aaagagcgag gtattactat taaagcccaa       180
     actgtacggc ttgtatataa agctaaaaac ggtaatactt attatttgaa tctaatggat       240
     actccagggc atgttgattt ttcatatgag gttagtaggt ccttggctgc atgtgaaggc       300
     tcgttattag tcgtggatag cactcaaggc gtagaggctc aaactcttgc aaatgtttat       360
     caagcaattg cgaatgatca tgagattgta ccagtgctta acaagattga tttagcagct       420
     tcagaacctg agcatgttaa gaagcaaata gaggatataa ttggaattga tgcaagtgaa       480
     gctgtcctaa tatctgctaa aaacggtata ggcattgatt cagttctaga agcaataatc       540
     aataaattac cttccccaaa agaaagtagc acagatacct taaaagcatt actggttgat       600
     agttggtacg atccatatct tggtgtagtt attttggtac gtattattga tggtacttta       660
     cgtaaaaata tgcgtgttaa aatgattggg acaaattctg tttatactgt tgagcatgtt       720
     ggttttttta ctccgaaaaa acatatttcg gatgttttat atgcagggga aattggtttt       780
     tttacagctt cgataaaacg ggtatcagat tgtaaagttg gtgatactat aactgatgag       840
     aaaaaatctt gcgaacaagc actacctggc tttaagccga atatacccgt agtgttttgt       900
     ggtttttatc cgacagatag tgcagaattt gaacatctaa aggactcttt agctaaatta       960
     cgtcttaatg atgccagttt tgagtatgaa atggaaagct cttcagctct tggggtaggt      1020
     tttaggtgtg gttttttagg gctattacat ttagagataa tacaagaacg tttaagtaga      1080
     gaattcaatt tagatttaat cactactgct ccaagtgtga tctataaaat ctatatgttg      1140
     gatggtgaga gcttagaaat tcataaccca gccgatttac ctgatttgca aaaaatagca      1200
     tcgatggaag agccatggat taaggcaact ataatggtgc cggatgagtt tataggcacg      1260
     gtattatcgc tttgtaaaga aaaaagaggt atacaacttg atcatagcta tatatcaaat      1320
     agagctaaaa tagtttataa attaccgtta aatgagatag tttatgattt ttatgatcgt      1380
     ttaaaaagct gttctaaagg ttatgcaagt tttgaatggc aaatggatgt ttatgaactt      1440
     tctgatcttg ttaatcttag gattttagtt aacggtgagg ttgttgatgc gttgtcaact      1500
     atagtacaca gatcacgtgc ggaacagcgt ggtagggctt tatgcgtaag attaaaggat      1560
     ttaataccaa gacagcaaat tgatatagcg attcaagcaa gtgttggtaa tcgtattatc      1620
     gctcgtgaaa ctattaaagc actacgtaaa gatgtgttat caaaatgtta tggtggtgat      1680
     ataagccgta aacgtaagct acttgagaag caaaaagcag gtaaaaagaa aatgagacag      1740
     tacggtaata tagaaattcc acaatctgca tttattgcag cattgcaaat tggaggtgaa      1800
     taa                                                                    1803
//

If you have problems or comments...

PBIL Back to PBIL home page