(data stored in SCRATCH3701 zone)

EMBL: AE017197.MKL

AE017197.MKL         Location/Qualifiers
FT   CDS_pept        complement(51270..52028)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mkl"
FT                   /locus_tag="RT0040"
FT                   /product="ribonucleotide ABC transporter ATP-binding
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:RT0040"
FT                   /db_xref="EnsemblGenomes-Tr:AAU03527"
FT                   /db_xref="GOA:Q68XW5"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q68XW5"
FT                   /protein_id="AAU03527.1"
FT                   /translation="MSTKEEFKIKIRSLYKSFANHKVLDGIDLDVKKGSSLVILGASGS
FT                   GKSVLIKNIVGLIKPDKGQIFIDNLEIQDISNKLKFEIMKGVGFLFQGGALFDSLNVRD
FT                   NITFDTKKLSKKEKNDLAGAKLNSVGLSTRILELYPSELSGGMQKRVALARAICNTPSI
FT                   LFLDEPTTGLDPIMANVINELIIKIQEELCATTITITHDMISTEKIAKEIAMIYHGKVQ
FT                   WYGSKEEMRNSDNPYLKQFINGLTTGPIEV"
     atgtcaacaa aggaagaatt taaaattaaa attcggtcat tatataaatc atttgctaat        60
     cataaggtgt tagatgggat agatttggat gtgaaaaaag gcagttcgtt agttatttta       120
     ggcgcttccg gtagcggaaa gtctgttctc attaaaaata tagtaggatt aattaaacct       180
     gataaaggcc aaatttttat tgataattta gaaatacaag atatttcaaa taaactcaaa       240
     tttgagatta tgaaaggtgt aggttttttg tttcagggtg gagcattatt tgactctttg       300
     aatgtacgtg ataatattac ttttgatact aaaaaattat ccaagaaaga aaaaaatgac       360
     cttgcaggtg caaagcttaa ttctgttggt ttatctacta gaatacttga gctttatcct       420
     tccgaattat caggaggaat gcaaaaaaga gtagcacttg ctagagctat ttgtaataca       480
     ccatcaattt tatttcttga tgaaccaaca acagggcttg accctataat ggcaaatgtt       540
     attaatgaat taattataaa aatccaagaa gaattatgtg caactaccat tactatcact       600
     catgatatga ttagtaccga aaaaatagct aaagaaatag cgatgattta tcatggcaaa       660
     gttcaatggt acggtagcaa agaggaaatg cgtaatagcg ataatcctta tttaaaacaa       720
     tttataaatg gattaactac tggtcctata gaggtataa                              759
//

If you have problems or comments...

PBIL Back to PBIL home page