(data stored in SCRATCH3701 zone)

EMBL: AE017197.MUTS

AE017197.MUTS        Location/Qualifiers
FT   CDS_pept        complement(365136..367811)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mutS"
FT                   /locus_tag="RT0289"
FT                   /product="DNA mismatch repair protein MutS"
FT                   /db_xref="EnsemblGenomes-Gn:RT0289"
FT                   /db_xref="EnsemblGenomes-Tr:AAU03769"
FT                   /db_xref="GOA:Q68X73"
FT                   /db_xref="InterPro:IPR000432"
FT                   /db_xref="InterPro:IPR005748"
FT                   /db_xref="InterPro:IPR007695"
FT                   /db_xref="InterPro:IPR007696"
FT                   /db_xref="InterPro:IPR007860"
FT                   /db_xref="InterPro:IPR007861"
FT                   /db_xref="InterPro:IPR016151"
FT                   /db_xref="InterPro:IPR017261"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036187"
FT                   /db_xref="InterPro:IPR036678"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q68X73"
FT                   /protein_id="AAU03769.1"
FT                   /translation="MTLCNMNLYEFRQKYNYDVATKMMQQYLDIKFAHLDCLLLFRMGD
FT                   FYELFYEDAILASNILGIALTKRGKNCEEEIPMCGVPYHALEHYLTKLITENYKVAICD
FT                   QLETPEEAKKRGGYKAVVTRDVTRIITPGTIIEENLISAAEPNYLTSLVMTKNKKTASI
FT                   CYVDLSTSKIFIVNVPETEILNELARLKSREILLSENLKSSNLADSILKQFNCRITYQV
FT                   DSFFAINKCEKIILDFYKIRDIKGIGEISSSQICAIGSILEYLSLTQKQNIPNLPIPKI
FT                   INFHSYMTIDFSTRRNLEIVTNIQGNLHGSVLNTLNHTVTKQGGRLLYHFLSSPLTNIA
FT                   KINRRLNITEFFYSNLGIVTRIRELLKNTSDIERCLTRITMNRSSGRDLLSIKYTLETA
FT                   KIINGLFSESHSLNLPNFIGKIIKPLSGDAELYNLIDMSIREDAPNNLNDGGIIKHEFH
FT                   PKVAQLNDLINNGKLHVEKLKDQYRKETGIDSLKISHNNVLGLFIDITAKNVNKILDPK
FT                   FIHRQTTVNSVRYTTYELQNLENELVNAQTLVISLEKELYTDICRKVIEKSSYLRILAN
FT                   SLSGLDVFCNFAYIADEYNYTKPEFTNDLSFDIVKGRHPVVEAALLKTSKSFVYNDCHL
FT                   SEAERICLITGPNMAGKSTYLRQNAIITIIAQIGSFVPAKSAKIGVVDKIFSRIGAADD
FT                   LIKGQSTFMAEMLETSAILAQSTKNSLIILDEVGRGTSTYDGVSIAWSVLEYIHDKLKC
FT                   RCLFATHYHELTVMKNFLPALQNYTIAIEESGKDILFLHNIILGTSNKSYGLHVAALAG
FT                   LPTSVINRAAQILLKFEKISISKGKNIVSTASNNLSLFNFEPQKHISNSKLDEEFKTID
FT                   PDKISPKEALELIYKFKKLV"
     atgaccttgt gtaatatgaa tctttacgag tttagacaaa aatataatta cgatgttgca        60
     acaaaaatga tgcaacaata tctagacatt aaatttgctc atttagattg tttgctacta       120
     tttagaatgg gtgattttta tgaactattc tatgaagatg caatcttagc aagtaatata       180
     cttggcatag ctttaacaaa aagaggtaaa aactgcgaag aagaaatacc aatgtgtggt       240
     gtgccttatc atgcacttga gcattactta actaagctaa ttacagaaaa ttataaagtt       300
     gctatttgcg atcagcttga aacccctgaa gaagcaaaaa agagaggtgg ctataaagca       360
     gtagtcacaa gagatgttac acgtattata actccaggaa ctataattga agagaactta       420
     attagtgcag cagaacctaa ttatttaaca agtctcgtaa tgacaaaaaa taaaaaaacg       480
     gctagcattt gttacgttga tctttctact tctaaaattt ttatagttaa tgtaccagaa       540
     acagaaattc tgaatgaact agcgcgttta aaatctcgtg aaattctgct gagcgaaaac       600
     ctaaagtctt ctaaccttgc tgatagtatt ttaaaacaat ttaattgtcg tattacctat       660
     caggtcgata gtttttttgc aattaataaa tgtgaaaaaa tcattttaga tttttataaa       720
     ataagagata ttaaaggcat aggtgagata tctagtagtc aaatttgtgc cataggcagt       780
     attttagaat atttatcatt aactcaaaaa cagaatattc ctaatttacc aatccctaaa       840
     attatcaatt ttcatagcta tatgactatt gatttctcta ctagacgtaa ccttgaaatt       900
     gtaacaaata tacaaggaaa cttacacgga agtgtactaa atacactaaa tcatacagtg       960
     actaaacaag gtggacgttt actatatcat tttctttcaa gtcctttaac taatattgct      1020
     aaaataaatc gtcgtttaaa tattaccgag ttcttttatt ctaacttagg aatagttaca      1080
     agaattagag aacttcttaa aaacactagt gatatagaac gttgcttaac acgtatcacg      1140
     atgaatagaa gttctggtcg tgacctactg agtattaaat atactttaga aacggcaaag      1200
     ataattaatg gattattttc tgaatctcat agtctaaatt tacctaattt tatcgggaaa      1260
     attattaaac ctctatcagg tgatgcagaa ttatataatt taatagacat gagtataaga      1320
     gaagatgcac cgaataattt aaatgatggt ggtataatta aacatgaatt tcatccaaaa      1380
     gtagcgcaac taaatgactt aattaataac gggaaattac atgttgaaaa gctaaaagat      1440
     caataccgca aagaaacagg catagacagt ttaaaaatat cccataataa tgttctaggg      1500
     ctttttattg atattaccgc taaaaatgtc aataaaattc ttgatcctaa atttattcat      1560
     cgtcaaacaa ctgtcaatag cgtacgttat actacatacg aattacaaaa tcttgaaaat      1620
     gaattagtga atgctcaaac cttagtaata agcttagaaa aagaattata tacagacatt      1680
     tgtaggaaag taatcgaaaa atcttcctat ttaagaatac tcgcaaactc cttaagtggg      1740
     cttgatgtat tttgtaattt tgcttatatt gctgatgaat ataattatac taaacctgaa      1800
     tttacaaatg acttaagctt tgatatagtt aaaggacgac atccagtagt agaagcagct      1860
     ttactaaaga ctagtaaaag ttttgtatat aatgactgtc atttatcaga agcagagcgt      1920
     atttgcttaa ttaccggtcc taatatggca ggcaaaagta cttatctgcg tcaaaacgct      1980
     atcattacaa tcattgctca aataggttct tttgtgcctg ctaaaagcgc taaaataggt      2040
     gtagttgata aaatatttag ccgaataggt gctgcagatg atttaattaa aggacaatca      2100
     acattcatgg cagaaatgct tgaaacttca gccattcttg ctcaatctac aaaaaactca      2160
     ctcattatcc ttgatgaagt tggcaggggc acttctactt atgatggagt atctatagca      2220
     tggtcagtac ttgaatatat tcatgataaa ctgaaatgtc gttgtttatt tgcaacacat      2280
     tatcatgagc taacagttat gaagaatttt cttcctgctt tacaaaacta tactatcgcc      2340
     attgaagagt caggtaaaga tattctgttt ttgcataata ttatattagg tacttccaat      2400
     aaatcttacg gtcttcacgt tgctgcttta gcaggactac ctacaagtgt cataaataga      2460
     gctgcacaga ttttactaaa atttgagaaa atttctataa gcaaaggaaa aaatattgta      2520
     tcaacggcat caaataactt gagtttattc aattttgaac ctcagaaaca tatatctaat      2580
     agtaagctag atgaagagtt taaaactatc gaccctgata aaatttctcc taaagaagcg      2640
     cttgagttga tttataagtt taaaaaattg gtttaa                                2676
//

If you have problems or comments...

PBIL Back to PBIL home page