(data stored in SCRATCH3701 zone)

EMBL: AE017197.NTRX

AE017197.NTRX        Location/Qualifiers
FT   CDS_pept        711324..712751
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ntrX"
FT                   /locus_tag="RT0550"
FT                   /product="nitrogen assimilation regulatory protein NtrX"
FT                   /db_xref="EnsemblGenomes-Gn:RT0550"
FT                   /db_xref="EnsemblGenomes-Tr:AAU04018"
FT                   /db_xref="GOA:Q68WH4"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR002078"
FT                   /db_xref="InterPro:IPR002197"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR025944"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q68WH4"
FT                   /protein_id="AAU04018.1"
FT                   /translation="MSQLDVLILDDEESIRNLIAANLKDEGFNPKVAANSTQALKIISE
FT                   KPVSAVILDIWLQGSEIDGLGVLEIIKKRYPLIPVIIISGHGTIETAVNAIKMGAYDYI
FT                   EKPFNNDKLIILLKRACEVTKLKRENIDLKSKVIDKTELVGGCSVTLKYKMEIEKAASS
FT                   SSRIMIHGKVGSGKELAARLIHKQSKRVNNPFIIFSPTCMTTEKINQELFGESEKQENN
FT                   NKRPTILEFANNGTLYIDEVSNIPIPIQVKLLKFLKDQTITKPCGKKTKVDIKIITSTS
FT                   KNIQDEVNNGKFLEDLYYRLNVFSLKVPSLYERKEDIPLLVKYFVKQLSKFSGLKERHF
FT                   SDEAITALQSYEWPGNIRQLRNVVEWTLIMNPLTTGNNEIIKPYMIPSEILANSANLTK
FT                   LEDSFDMLSMPLREAREVFERQYLSAQMSRFNNNISKTSSFVGMERSALHRKLKLLSLH
FT                   IPPTNKINEEEYEKANA"
     atgtcacaat tagatgtttt aatattagac gatgaagaga gtatacgaaa tctcattgct        60
     gcaaatttga aagatgaagg ttttaatccc aaggttgccg ctaatagtac tcaagctctt       120
     aaaataattt ctgaaaaacc agtctctgca gtgatacttg atatttggct tcaaggtagc       180
     gaaattgacg ggcttggagt tttagagata attaaaaaac gttatccttt aataccggta       240
     atcattatta gcggtcacgg tactatagaa acagcagtta atgcgataaa aatgggagct       300
     tacgattata tcgagaaacc atttaataat gataaattaa ttattttact taaaagagct       360
     tgcgaagtaa caaaattaaa acgtgaaaac atagatttaa aatcaaaggt tatagataaa       420
     actgaattag ttggaggatg ttcagtaact ttaaaatata aaatggaaat agaaaaagca       480
     gctagctcta gcagtcgtat aatgattcat ggtaaagtcg gtagcggcaa agaacttgca       540
     gcaagattaa ttcataaaca atctaagaga gttaataatc catttattat ttttagccca       600
     acctgcatga ctacagaaaa aattaatcaa gaattatttg gagaatcaga aaagcaggag       660
     aataataata aacgtcctac tatcttagaa tttgcaaata atgggacttt atatatagat       720
     gaggtcagta atattcctat tcctatccag gtaaaattat taaaattcct taaagatcaa       780
     actattacaa aaccttgtgg gaaaaagact aaagttgata taaaaattat taccagtact       840
     tctaaaaata tccaagatga agtaaataac ggaaaatttc tagaagatct atattatcgc       900
     cttaatgtat tttctctaaa agtaccttca ttatatgaaa gaaaagaaga tataccacta       960
     ctagttaaat attttgttaa gcaactttca aaattttcag gtttaaaaga acgtcatttt      1020
     tctgatgaag ctattacagc tcttcaatcc tacgaatggc ctggtaatat tagacaatta      1080
     cgtaacgttg ttgaatggac tttaattatg aatccgttaa ctacaggtaa taatgaaatt      1140
     ataaaacctt atatgatacc ttcagaaata ttagcaaata gtgctaatct tacaaaactt      1200
     gaagacagct ttgatatgtt atctatgccg cttagagaag cgagagaagt ttttgagcgt      1260
     caatatctat cagcgcaaat gagccgtttt aataataata tttcaaaaac ttcttcattt      1320
     gtcggtatgg aaagatcagc tttacatcga aaattaaaat tattaagcct acatatacca      1380
     ccaacaaata aaataaatga agaagaatat gagaaagcaa atgcttaa                   1428
//

If you have problems or comments...

PBIL Back to PBIL home page