(data stored in SCRATCH3701 zone)

EMBL: AE017197.NTRY

AE017197.NTRY        Location/Qualifiers
FT   CDS_pept        complement(783022..784827)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ntrY"
FT                   /locus_tag="RT0603"
FT                   /product="nitrogen regulation protein NtrY"
FT                   /db_xref="EnsemblGenomes-Gn:RT0603"
FT                   /db_xref="EnsemblGenomes-Tr:AAU04067"
FT                   /db_xref="GOA:Q68WC5"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q68WC5"
FT                   /protein_id="AAU04067.1"
FT                   /translation="MSMLSYLKQNLCFYLSSKILILALAISAIVSACTTFYVISLEAKN
FT                   FSTIIGFLLIDLAIFLILGILLTQKFFSKNNDNDSSRLQNRIVIAFSLVAAIPTIIVSV
FT                   FSVYFFNLSVKAWFDKKISTVLDQSVIVAETYIAEHKVQLKETALAVAEDLSDMYYDLI
FT                   HNPALFTKTLNTEADMRSLDEAIVLNKSTNTIVANSYLSFSLSFATIPAHLIKKADLGE
FT                   PVEVKSDPTKIRMLIKLKEYNDVYLLVGRLVDNKIIDHIDATNGAAAEYNSLKNEIDNI
FT                   QIKFSIMFIFIALLLLFVAINFGVLFTAQIVKPIKKLVTATDKVKDGDLTVQVPENEVD
FT                   KDEIGTLYVAFNRMIKQLSRQQRDLVIAQRAMAWSDVAKKVAHEIKNPLTPILLASERL
FT                   LKKFSAEIKDKSEFESYLKMIIRHTNDIKNIVSEFVLFARLPAPKFTKSELVYLVKHII
FT                   EARKLLNDNIVYTCDSNVDQFDFMCDATQINQVMINVLKNAEESIEGQEFGRIDVILDI
FT                   KDDFINVIVMDNGKGFPPELIGKATESYVTTSSKGMGVGLAIVKRIVEEHCGVLDIANR
FT                   EDKGAIIDIKFDLKELHLKVRRSCG"
     atgtctatgc ttagttattt aaaacaaaat ttgtgctttt atttgtctag taaaatacta        60
     attcttgctt tagcaatatc agctattgtt tcagcttgta ctacttttta tgtgatatct       120
     ttagaagcaa agaattttag tacgattatt ggatttttgt taattgattt agcaattttt       180
     ttgattttag gtattttact aactcaaaag tttttttcta aaaataatga taacgatagt       240
     tctagattac aaaatcgtat tgtaattgca tttagtttag tagctgctat tccaactata       300
     attgtttctg tattttctgt ttattttttt aatcttagtg ttaaagcatg gtttgataag       360
     aagatttcta ccgtgcttga tcaatctgta atagtagctg aaacttatat tgctgagcat       420
     aaagtacagt taaaagaaac agctttagca gttgccgaag atttaagcga tatgtattac       480
     gatttaatcc ataatcctgc tttatttact aaaacactta ataccgaagc agatatgcgc       540
     tcgcttgatg aagcgatagt tttaaataaa tctaccaata ctatagtagc taatagttat       600
     ttaagttttt cattatcatt tgcaactatt ccagcacact taattaaaaa agctgattta       660
     ggggaaccag tagaagtaaa atccgaccca actaaaatca ggatgttaat taaattgaaa       720
     gaatataatg atgtgtattt attagtcggt agactagtag ataataaaat tatcgatcat       780
     atagatgcaa ctaacggagc agctgccgag tataatagcc ttaaaaatga aatagataat       840
     atacagatta agttctctat aatgtttatc tttattgcat tattacttct ttttgtagcg       900
     ataaattttg gtgttttatt tactgctcaa atagtaaaac cgattaaaaa attagttact       960
     gcaaccgaca aagttaaaga tggtgattta acagtgcagg ttcctgaaaa tgaggtagat      1020
     aaagacgaaa taggaacgct ttatgtagca tttaatagaa tgattaagca gctttcgcgt      1080
     cagcagcgtg atttagttat agcacagagg gctatggctt ggtcggatgt tgcaaaaaaa      1140
     gtagctcatg aaattaagaa cccattaact cctattttac ttgcttctga aaggttactt      1200
     aagaaattta gcgctgaaat taaggacaag tcagaatttg aaagttattt aaaaatgatt      1260
     attcgtcata ctaacgatat taaaaatata gtatccgaat ttgttctgtt tgcacgtctt      1320
     cctgctccta aatttacgaa gagtgaatta gtttatttag taaaacatat tattgaagca      1380
     cgtaaattac ttaatgataa tattgtgtat acatgtgatt ctaatgtaga tcaatttgat      1440
     tttatgtgtg atgctacaca aataaatcaa gtgatgatca atgtgttaaa aaatgctgaa      1500
     gagtcaatag aaggacaaga attcgggaga atagatgtta ttttagatat taaagatgat      1560
     tttatcaatg ttattgtaat ggataacggt aaaggatttc ctcctgagct cataggtaaa      1620
     gctaccgaaa gctatgtaac aaccagcagt aaaggtatgg gtgtagggct tgctatagtt      1680
     aaaagaatag tagaagagca ttgtggtgtt ttagatatcg caaacagaga agataaaggg      1740
     gcaataatcg atataaaatt tgatttaaaa gaactgcatt tgaaagttag acgttcttgt      1800
     ggttag                                                                 1806
//

If you have problems or comments...

PBIL Back to PBIL home page