(data stored in SCRATCH3701 zone)

EMBL: AE017197.NUSA

AE017197.NUSA        Location/Qualifiers
FT   CDS_pept        complement(691129..692640)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="nusA"
FT                   /locus_tag="RT0540"
FT                   /product="transcription elongation protein NusA (N
FT                   utilization substance protein A)"
FT                   /db_xref="EnsemblGenomes-Gn:RT0540"
FT                   /db_xref="EnsemblGenomes-Tr:AAU04009"
FT                   /db_xref="GOA:Q68WI3"
FT                   /db_xref="InterPro:IPR003029"
FT                   /db_xref="InterPro:IPR004087"
FT                   /db_xref="InterPro:IPR009019"
FT                   /db_xref="InterPro:IPR010213"
FT                   /db_xref="InterPro:IPR010214"
FT                   /db_xref="InterPro:IPR010995"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR013735"
FT                   /db_xref="InterPro:IPR015946"
FT                   /db_xref="InterPro:IPR022967"
FT                   /db_xref="InterPro:IPR025249"
FT                   /db_xref="InterPro:IPR030842"
FT                   /db_xref="InterPro:IPR036555"
FT                   /db_xref="UniProtKB/TrEMBL:Q68WI3"
FT                   /protein_id="AAU04009.1"
FT                   /translation="MSNIYNVEILQIIDSVAREKGISKEILIATVEQAIQVAGRKKYGN
FT                   EYNIKAQINRKTGEINLLRILKIVEDVEDYLTQISLEDALVKNPEAKIGDEIYEYLPPI
FT                   DYARVSAQAAKQVITQRVIEAEREKQYNDFKDRKGDIINGIVKRIEYGDIIVDLGRAEA
FT                   IIKKDQLIKGEHFKPNDRIKAYVQDVRQETKGPQIFLSRVDNKMLVKLFKLEVPEILED
FT                   IIQVKSVARDPGSKAKIAVFASDSSIDPVGSCVGIRGNRVKAVTNELNGEKIDIVLWSN
FT                   DLAQFIVNSLVPLAPSEITKILIDEDSHKVEVVVSQENQSIAIGRRGQNVRLASKLTGW
FT                   NIDIMTEEQESKRRNEEFSTSTELFMEALDVEEVIGQLLSVTGFNSVEQIASSEISTLT
FT                   RIEGFEEELAVEIKNRAIRYVDLKNEQIIKKLEELGVEQELIDILELPLELILKFAEYG
FT                   IKTIEDLGEMSVNEFKNLAPNSNITDDNIKLLIKTARHHGELKDS"
     atgtctaata tatataatgt agaaatttta caaattatag attctgtagc acgtgagaaa        60
     ggaatatcaa aagaaatttt gattgcaacc gttgaacaag ctatacaagt agcaggacgg       120
     aaaaaatatg gtaatgaata taatattaaa gcgcagataa ataggaaaac cggtgagata       180
     aatcttttga ggatcttaaa aatagtagaa gatgtagaag attatttaac gcaaatttca       240
     cttgaagatg ctttagtaaa aaatccggaa gctaaaatcg gtgatgagat atatgaatat       300
     ttaccaccaa ttgattatgc tagagtatcg gcacaagctg caaaacaagt tataactcaa       360
     cgtgttatag aagctgaacg tgaaaaacaa tataatgatt ttaaagatag aaaaggtgac       420
     attataaatg gaatagttaa gaggatagaa tacggtgata taatagttga cttaggtcgt       480
     gctgaagcaa taataaaaaa agatcagtta attaagggtg aacactttaa acctaatgac       540
     cgtataaaag catatgtaca ggatgtaagg caagaaacaa aggggccaca aattttcttg       600
     tctagagtag ataacaaaat gttggttaag ttatttaagt tagaggttcc tgaaattctt       660
     gaagatatta ttcaagtaaa atcagtagca cgtgatccag gttcaaaagc aaaaatagca       720
     gtatttgctt cggatagtag tatagatcca gtaggttcgt gcgtaggtat tagaggtaat       780
     agagtaaaag ctgtaacaaa tgagttaaat ggcgagaaaa ttgatatagt attatggagt       840
     aatgatcttg cacagtttat agttaattct cttgtgcctc ttgcaccaag tgaaattaca       900
     aaaattttga ttgatgagga tagtcataag gtagaagtag tagtgtcgca agaaaatcaa       960
     agtattgcaa taggtagaag agggcagaat gttcgcttag cttctaagct aaccggttgg      1020
     aatatcgata taatgaccga agagcaagaa tcaaaaagaa gaaatgaaga attctcaact      1080
     tctacggaat tatttatgga agctttagat gttgaagaag ttataggtca gcttttatcg      1140
     gtaacaggct ttaattctgt agaacaaatt gctagtagtg agattagtac tttaacaaga      1200
     attgaaggtt ttgaggaaga gcttgctgta gagatcaaaa atcgagctat tcgttatgta      1260
     gatctaaaaa atgaacagat tatcaaaaag ctggaagagt tgggtgttga gcaagaatta      1320
     atagatatat tagaattacc gcttgaatta atattaaagt ttgccgaata tggtataaag      1380
     acaatagaag atttgggaga gatgagtgta aatgaattta aaaatttggc tccaaattct      1440
     aatataacgg atgataatat taaattattg attaaaactg ctagacatca tggtgaatta      1500
     aaggatagtt ag                                                          1512
//

If you have problems or comments...

PBIL Back to PBIL home page