(data stored in SCRATCH3701 zone)

EMBL: AE017197.NUSB

AE017197.NUSB        Location/Qualifiers
FT   CDS_pept        193868..194389
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="nusB"
FT                   /locus_tag="RT0152"
FT                   /product="transcription termination protein NusB (N
FT                   utilization substance protein B)"
FT                   /db_xref="EnsemblGenomes-Gn:RT0152"
FT                   /db_xref="EnsemblGenomes-Tr:AAU03636"
FT                   /db_xref="GOA:Q68XK6"
FT                   /db_xref="InterPro:IPR006027"
FT                   /db_xref="InterPro:IPR011605"
FT                   /db_xref="InterPro:IPR035926"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q68XK6"
FT                   /protein_id="AAU03636.1"
FT                   /translation="MTLDVIVIHNNKNYKFLLSMSTNKINKKSIARIAAVQALYQNILQ
FT                   NNYDMYDIMQNILACYHSNSIDLPKNFKISLSISHFKMLVKSVFENINKLDEIIDNHLT
FT                   NDKDPVHMPILLRALLRVSICELLFCSTTPAKVVINEYTDIANDLLNEHEIGFVNSILD
FT                   KIAQENNKIS"
     atgacattgg atgtaatagt tattcacaat aacaaaaatt ataaatttct tttatctatg        60
     agtacaaata aaattaataa aaagtctatt gcacgtattg cagcagtgca agctctttat       120
     caaaatatat tgcaaaataa ctatgatatg tatgatatta tgcaaaatat actagcttgt       180
     tatcacagta attctataga cttacctaag aattttaaga tatcattaag tataagtcat       240
     tttaaaatgc tggtaaagtc agtatttgaa aatattaata aattagacga aattatcgac       300
     aatcatttaa caaatgataa agatcctgta catatgccaa tcttactccg agctttattg       360
     cgtgttagta tatgtgagtt attattttgt tctactactc ctgctaaagt agtaatcaac       420
     gaatatacag atatagcaaa tgatttgtta aatgaacacg agattggttt tgtaaattca       480
     atcttagaca aaatagctca agaaaataat aaaatttcat ga                          522
//

If you have problems or comments...

PBIL Back to PBIL home page