(data stored in SCRATCH3701 zone)

EMBL: AE017197.NUSG

AE017197.NUSG        Location/Qualifiers
FT   CDS_pept        157349..157927
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="nusG"
FT                   /locus_tag="RT0124"
FT                   /product="transcription antitermination protein NusG (N
FT                   utilization substance protein G)"
FT                   /db_xref="EnsemblGenomes-Gn:RT0124"
FT                   /db_xref="EnsemblGenomes-Tr:AAU03609"
FT                   /db_xref="GOA:Q68XN3"
FT                   /db_xref="InterPro:IPR001062"
FT                   /db_xref="InterPro:IPR005824"
FT                   /db_xref="InterPro:IPR006645"
FT                   /db_xref="InterPro:IPR008991"
FT                   /db_xref="InterPro:IPR014722"
FT                   /db_xref="InterPro:IPR015869"
FT                   /db_xref="InterPro:IPR036735"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q68XN3"
FT                   /protein_id="AAU03609.1"
FT                   /translation="MTEQTIDNILPASKNNVKQWYVVHTASGAEKRIKEDILRKIAKQK
FT                   MTDFFEDILIPVFGVSEVKRGKNVKVEKKLMPSYILIKMNMTDKSWHLVKNISGVTGFL
FT                   GSKIVPKALTESEIQNIFNNLEAEAKVAKNSKLYEVGEVVTVTDGPFETFMGTVEEIDK
FT                   ERNRLKVSVSIFGKATPIELNFNQVKKND"
     gtgacagaac agactataga taatatatta cctgcttcta agaataatgt aaagcagtgg        60
     tatgtagtac atactgcatc aggagcagag aaacgcatta aagaagatat tcttagaaaa       120
     atcgctaaac aaaaaatgac agattttttt gaggatatat taatacctgt ttttggagtt       180
     tctgaagtta aacgtggtaa aaatgtcaag gtagaaaaaa aactaatgcc aagttatatt       240
     ttaataaaaa tgaatatgac tgataaatca tggcatttag taaaaaatat atctggcgta       300
     actggttttt taggaagtaa aattgtacca aaagctctta cagaaagtga aatacaaaat       360
     atttttaata atttggaagc agaagcgaaa gtagcaaaga actctaaatt atatgaagtt       420
     ggtgaggtag taactgttac agatggtcct tttgaaactt ttatgggaac agtagaagaa       480
     atagataaag aaagaaatag attaaaggtt tcagtttcaa tatttggtaa agcaactcca       540
     atagaactaa attttaatca agtaaagaaa aatgattaa                              579
//

If you have problems or comments...

PBIL Back to PBIL home page