(data stored in SCRATCH3701 zone)

EMBL: AE017197.OMPR

AE017197.OMPR        Location/Qualifiers
FT   CDS_pept        complement(525218..525886)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ompR"
FT                   /locus_tag="RT0413"
FT                   /product="response regulator protein OmpR"
FT                   /db_xref="EnsemblGenomes-Gn:RT0413"
FT                   /db_xref="EnsemblGenomes-Tr:AAU03890"
FT                   /db_xref="GOA:Q68WV2"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR001867"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR039420"
FT                   /db_xref="UniProtKB/TrEMBL:Q68WV2"
FT                   /protein_id="AAU03890.1"
FT                   /translation="MQPHILIVDDDSRILALLKQFLNKNNFLVSTANSVIEAKNLLKTS
FT                   NYDLIILDVMLPEITGLDFATTIRDAGNTIPIVMLTALSEANERVKGLEAGASDYITKP
FT                   FEPRELLLRINNLINNYNFKKATNIIKFGNNLYNCTTKEFTKNNQIVSLSSTEQKLLEI
FT                   LIKNSGKSTSRFELSKIMGGLSMRSIDVQITRIRSKIEDNPKEPKYLKTVRNDGYALYI
FT                   "
     atgcaaccac atattttaat tgtagatgat gatagcagaa tattagcact tttaaagcag        60
     tttttaaata aaaataactt tttagtatca acggcaaact cagttataga agctaaaaat       120
     ctattaaaaa cttctaatta tgatctaatc attttagatg ttatgttacc tgaaataaca       180
     gggcttgatt ttgccactac tataagggat gctggtaata ctattcctat agttatgctt       240
     actgctttat cagaagccaa tgagcgtgtt aaagggcttg aagctggtgc atctgattat       300
     atcactaaac cttttgaacc aagagaatta ttactgcgaa taaataactt aatcaataac       360
     tataacttta agaaagcaac aaatataatt aaatttggca ataatttgta taattgcact       420
     acaaaagaat ttactaaaaa taatcaaatt gtatctctta gctctactga gcaaaaacta       480
     cttgagatat taataaaaaa ttccgggaag tctactagtc gttttgaact ttcaaaaata       540
     atgggaggac tgagtatgcg ttctatagac gtacagatta caagaataag aagtaaaata       600
     gaagataacc caaaagaacc aaaatattta aaaacagtgc gtaatgatgg ctatgcactt       660
     tatatctaa                                                               669
//

If you have problems or comments...

PBIL Back to PBIL home page