(data stored in SCRATCH3701 zone)

EMBL: AE017197.PARA

AE017197.PARA        Location/Qualifiers
FT   CDS_pept        complement(96166..96933)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="parA"
FT                   /locus_tag="RT0074"
FT                   /product="chromosome partitioning protein ParA (Soj
FT                   protein)"
FT                   /db_xref="EnsemblGenomes-Gn:RT0074"
FT                   /db_xref="EnsemblGenomes-Tr:AAU03560"
FT                   /db_xref="InterPro:IPR025669"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q68XT2"
FT                   /protein_id="AAU03560.1"
FT                   /translation="MKIIAIVNQKGGVAKTTTTVNLATAFASVNKKILVIDLDPQGNSS
FT                   TGFGIIQQQRKNTIYQVLTNLIELKDAIISTNIPNLEIITSNTNLSAAELDLTTLKDRE
FT                   YILMKLLEEVKILYDYIIIDCPPSLNLLTVNALVASDEVLIPMQCDFYSLEGLSNLLKT
FT                   IEIVEKKLNPKIKIAGILFTMYDKRNRLTEQVEDDVRKCLGELVFKTVIPRNIKLSEAP
FT                   SYGKPAILYDYKCAGAMAYIELTKEILERYGKK"
     atgaaaataa ttgctattgt taatcaaaaa ggaggggttg ctaaaactac aactacggta        60
     aatttagcta cagcttttgc ttcggttaat aaaaaaattt tagtgataga tcttgatcct       120
     caagggaata gtagtactgg ttttggaatt attcagcaac aacgtaaaaa tactatatac       180
     caggtattaa caaatttaat agaattgaaa gatgcaataa tttctacaaa tataccaaat       240
     ttagaaataa ttacttcaaa cactaattta tctgccgctg aattagattt aacgacatta       300
     aaagaccgag aatatatttt aatgaagctt ttggaagaag taaaaatatt atatgattat       360
     ataattattg attgtcctcc ttcattgaac ttattaactg taaatgcttt ggttgcaagt       420
     gacgaagtat tgattccaat gcaatgtgat ttttattcgt tagaaggttt aagtaactta       480
     ctaaaaacaa ttgaaattgt agaaaaaaaa ttaaatccta agataaagat tgctggtata       540
     ttatttacaa tgtatgataa acgcaatcgt ttaactgagc aagtagaaga tgatgttaga       600
     aaatgtttag gagaattggt atttaaaacc gttattccga gaaatattaa actatctgaa       660
     gctccttcat atggaaaacc ggctattcta tatgattata aatgtgcagg agcaatggca       720
     tatatagaac ttacaaaaga aatcttagaa agatatggta aaaaataa                    768
//

If you have problems or comments...

PBIL Back to PBIL home page