(data stored in SCRATCH3701 zone)

EMBL: AE017197.PARC

AE017197.PARC        Location/Qualifiers
FT   CDS_pept        complement(84353..86566)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="parC"
FT                   /locus_tag="RT0065"
FT                   /product="DNA topoisomerase IV subunit A"
FT                   /EC_number="5.99.1.-"
FT                   /db_xref="EnsemblGenomes-Gn:RT0065"
FT                   /db_xref="EnsemblGenomes-Tr:AAU03551"
FT                   /db_xref="GOA:Q68XU1"
FT                   /db_xref="InterPro:IPR002205"
FT                   /db_xref="InterPro:IPR005742"
FT                   /db_xref="InterPro:IPR006691"
FT                   /db_xref="InterPro:IPR013757"
FT                   /db_xref="InterPro:IPR013758"
FT                   /db_xref="InterPro:IPR013760"
FT                   /db_xref="InterPro:IPR035516"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q68XU1"
FT                   /protein_id="AAU03551.1"
FT                   /translation="MKEAKIENIDFGNALSERYLAYALSTIMSRSLPDVRDGLKPVHRR
FT                   LLYAMLQLRLEPNSGYKKCARVVGDVIGKYHPHGDVAVYDTLVRLAQHFSLRYPLIDGQ
FT                   GNFGSIDGDNAAAMRYTESRMTEICMLLMKDIDKDTVDFRSTYDDSDLEPVIMPASFPN
FT                   LLANGSEGIAVGMATNIPPHNLHELCDALLYLIDNPQAGVNDIMNFIKGPDFPTGGIII
FT                   DQTKVINAAYTTGRGSFRVRSRWEKEELSYGTYQIVVTEIPYQVQKSKLIEQIAILLKD
FT                   KKIPLISSIRDESTDIIRLVIEPRDRSCDPQIVMESLFKLTNLESRIQLNMNVIGSNNV
FT                   PRVMNIVEILQEFLVHRQNIITRRSTYLLNKIKQRLEILKVLKIVYLNLDEIIEIIRRE
FT                   DEPKTIIMERFKISEIQVEVILNTRLRALQKLEEHAIIDEHSNLQKQQAILEKILKNHK
FT                   ELWKIVKKEIKSVQTQFGLNTIIGARRTSFEEVDLTNQVIDITAFITKEPITIICSKMG
FT                   WIRLLKGHNTDLSTIKYKEGDAEKFIIEAYTTDKILIISSKGRFFTLLADNISKGKGTA
FT                   VSIKLLVDIGNNDITNILVYKPYQLLLLASSIGKGFLVNSNEVIAQTKAGKQIMNIPEG
FT                   YACITCLPVNGNSIACINESRRLLIFNINEIPEMKKGQGVVLQRFKNAKLLDIKIFNKE
FT                   DGLSWNDGKKIQLEKNIVAFLGKRGSAGTLPPIGFPKNNRFSS"
     atgaaagaag ctaaaataga aaatattgac tttggtaatg ctttatcaga gcgttatctt        60
     gcttatgcat tatcgactat tatgtcacgt tcacttcctg acgtacggga cggactcaaa       120
     cctgtacatc gtaggttatt atacgcaatg ttacaactaa ggcttgagcc taattctgga       180
     tataagaaat gtgcaagagt ggttggtgac gtaataggta aataccaccc gcacggtgat       240
     gttgcagtat atgatacctt ggtacgactt gcacagcatt tttcattgcg ttatcctttg       300
     attgacggtc agggtaattt tggctctata gatggtgata atgcagcagc tatgcgctat       360
     actgaatcac gtatgacgga aatatgcatg ttattaatga aggacattga taaagatacg       420
     gtagacttcc gttctactta tgatgattct gatttagagc cggtaataat gccggcaagt       480
     tttcctaatt tgcttgctaa cggctctgaa ggtatagcag ttggtatggc aacaaatata       540
     ccaccgcata atttacatga gttatgtgat gctttattgt atttaatcga caatccgcaa       600
     gctggggtta acgatataat gaactttatc aaaggccctg attttccaac tggtggtata       660
     attattgatc aaactaaagt tattaatgct gcatatacta ctggacgtgg tagttttaga       720
     gtaagaagta gatgggagaa agaggaactg agttacggta catatcagat agttgtcact       780
     gaaatacctt atcaggtaca gaaatcaaaa cttatagaac aaatagcaat attactaaaa       840
     gataaaaaaa ttccgcttat tagcagtatt agagatgaat caactgatat tataaggttg       900
     gttatagaac caagagatcg tagttgtgat ccacagatag ttatggagtc tctatttaag       960
     ctcactaatt tagaaagtcg tattcaacta aatatgaatg tgataggtag taataacgtg      1020
     ccgagagtaa tgaatattgt agagattcta caagaatttt tagttcatag acaaaatatt      1080
     attactcgta ggtcaactta tcttttgaat aaaatcaagc agcgtttaga aattttaaaa      1140
     gtgcttaaaa tagtttattt aaaccttgac gagataattg aaattatccg tagagaggat      1200
     gagccaaaaa caataattat ggagcggttt aaaataagtg aaatacaagt agaagtaata      1260
     ttaaacactc gtcttcgtgc actccaaaaa cttgaagagc atgcaattat tgatgagcat      1320
     agtaatttgc agaagcaaca agctatatta gaaaagattt taaaaaatca taaagaacta      1380
     tggaaaatag tgaaaaaaga aatcaaatca gtacaaactc aatttggatt aaatacaata      1440
     ataggagcaa ggcgtacaag ttttgaagaa gtagatctta caaatcaagt tattgatata      1500
     actgcgttca ttactaaaga acctattact attatctgct caaaaatggg gtggatacgt      1560
     ttactaaaag gacataacac tgatttatca actattaaat ataaagaagg tgatgcggaa      1620
     aagtttatta tagaagccta tacaactgat aaaatattaa taattagttc aaaaggaaga      1680
     ttttttactt tgcttgcaga taatatttct aaaggtaaag gtactgctgt atctataaaa      1740
     ctacttgtgg atataggtaa taacgacatt actaatattt tagtctataa accttatcag      1800
     cttttattac ttgcaagtag tatcggtaaa ggatttttag ttaattcaaa cgaagtaata      1860
     gctcaaacaa aagcaggaaa gcaaattatg aatataccag aggggtatgc atgtataaca      1920
     tgcttacctg taaatggcaa tagtattgct tgtatcaatg aaagtcgtag attacttata      1980
     tttaatataa atgaaatacc tgaaatgaaa aaagggcaag gtgtagtgct gcaaaggttt      2040
     aagaatgcaa aacttttaga tattaaaata tttaataaag aagatggttt aagttggaat      2100
     gatggcaaaa aaatacaact tgaaaaaaat attgtcgcat ttttagggaa aagaggtagt      2160
     gccggtacat tgccacctat tggcttccct aaaaataata gattttcatc ataa            2214
//

If you have problems or comments...

PBIL Back to PBIL home page