(data stored in SCRATCH3701 zone)

EMBL: AE017197.PARE

AE017197.PARE        Location/Qualifiers
FT   CDS_pept        282215..284206
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="parE"
FT                   /locus_tag="RT0219"
FT                   /product="DNA topoisomerase IV subunit B"
FT                   /EC_number="5.99.1.-"
FT                   /db_xref="EnsemblGenomes-Gn:RT0219"
FT                   /db_xref="EnsemblGenomes-Tr:AAU03701"
FT                   /db_xref="GOA:Q68XE1"
FT                   /db_xref="InterPro:IPR001241"
FT                   /db_xref="InterPro:IPR002288"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR005737"
FT                   /db_xref="InterPro:IPR006171"
FT                   /db_xref="InterPro:IPR013506"
FT                   /db_xref="InterPro:IPR013759"
FT                   /db_xref="InterPro:IPR013760"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR018522"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q68XE1"
FT                   /protein_id="AAU03701.1"
FT                   /translation="MSDLFSFNNKEKKNKIIYTNYSAKDIEVLDGLEPVRKRPGMYIGG
FT                   TDSNAMHHLVSEVLDNAMDEAVAGFASIIMIKMHQDHSITIFDNGRGIPIDNHPKFPNK
FT                   SALEVILTTLHSGSKFSNNVYHTAGGLHGVGISVVNALSKHLKIEVYQQGKLYSQSYSK
FT                   GEKLTDLISTEVSKRLRGTSINFTPDPEIFSETLHFNPKKIYEIARSKAYLYRGVSIEW
FT                   ECEVEVPSDIPKKALINFPNGLKDYLSSKISLDNLVIPEIFSGNIESTMDAIKLEWAIC
FT                   WQNNDTSAFMKSYCNTVPTPQGGTHEQGLKSAILRGLKAYSEMIGNKKSANLTIEDIFE
FT                   TASVVLSVFIVEPSFQGQTKEKLVSNGVSKLVENIIKDHFDHFLSSDKVLATHLLEHVI
FT                   AISEFRRNKKNERNISRKNATQKLRLPGKLADCTRTSAEGTELFIVEGDSAGGSAKQAR
FT                   NRETQAVLPLWGKVLNVASSTLEKIINNQAIQDLEIALACGSLKNYKKENLRYEKIIIM
FT                   TDADVDGAHIASLLMTFFFLRMPQLVKEGHLYLAKPPLYRLTQSNKIYYACDEEEKIKL
FT                   TYKLSKTSKAKIEVGRFKGLGEMMPAQLKETTMHPEKRSLLKVTLEDVQNVDKIVDDLM
FT                   GKKPEKRFQFIYEQALVKMDQIINKLDI"
     atgagtgatt tattcagctt taataataaa gaaaagaaaa ataagataat ctatactaat        60
     tatagtgcaa aagatattga agtattagat ggtcttgagc ctgtgcgtaa aagacctggt       120
     atgtatattg gaggtactga ttcaaatgct atgcatcatt tagtatctga ggtccttgat       180
     aatgctatgg atgaagcagt agccggcttt gcaagtatta tcatgataaa aatgcatcaa       240
     gatcatagta ttactatatt tgataatggt cgtggtatcc ctattgataa tcatcctaaa       300
     tttcctaata aatctgcttt agaagtaatt ttaactactc ttcattcagg tagtaaattc       360
     tcaaataatg tttatcatac tgcaggtgga ctacacggtg taggaatatc ggtagtaaat       420
     gctttatcta aacatttaaa aatagaggtt tatcaacaag gtaaattata tagccaaagt       480
     tattctaaag gagaaaaatt aactgattta atatctacag aagtatctaa aaggctaaga       540
     ggtacatcaa taaattttac tcccgatcca gaaattttta gtgaaacatt acattttaat       600
     cctaaaaaga tttatgagat tgcaaggtca aaagcttatt tatatcgtgg tgtttctata       660
     gaatgggaat gtgaagtaga agtgccatca gatataccta aaaaagcatt aataaatttt       720
     ccgaacggtt taaaagatta tttaagttca aaaatatctt tagataattt agttattcca       780
     gaaatttttt caggtaatat agagtctacg atggacgcta taaaacttga atgggctatt       840
     tgttggcaaa ataatgatac atcagcattt atgaaatcat attgtaacac tgtacctact       900
     cctcaaggag gcacacatga gcaaggactt aagtcagcta ttttacgtgg gcttaaagca       960
     tacagtgaaa tgataggtaa taaaaaatct gctaatctca ctattgagga tatttttgaa      1020
     acagcgagtg ttgttctttc agtttttata gttgagccat cttttcaagg tcaaactaag      1080
     gaaaaattag tatcaaacgg tgtaagtaaa cttgttgaga atataataaa agatcatttt      1140
     gatcacttcc ttagtagtga taaagtttta gcaactcatt tactcgagca tgtaattgct      1200
     atttctgagt ttagaagaaa caagaaaaac gaaagaaata tttcgcgtaa aaatgccact      1260
     caaaaattac gtttacctgg taagcttgct gattgtacgc gtacttcagc tgaagggacg      1320
     gaactattta ttgtagaagg tgattcagca ggaggttctg caaaacaagc acgtaataga      1380
     gaaacacaag cagtattacc tttatggggt aaagtgctaa atgttgcgag ttctacactt      1440
     gaaaaaatca ttaataatca agcaatacaa gatttagaaa tagctcttgc ctgtggtagt      1500
     ttaaagaatt ataaaaaaga aaatttgcgt tatgaaaaaa taattattat gactgatgca      1560
     gatgttgacg gtgctcatat agcttcgtta ttaatgactt tctttttttt acgaatgccg      1620
     caattagtaa aagaagggca tttatattta gctaagcctc cactttatcg tttaacgcag      1680
     tctaataaaa tttattatgc atgtgatgaa gaggaaaaaa ttaagttaac gtataaatta      1740
     tcgaaaacta gtaaagctaa aattgaagta ggtaggttta aaggtctcgg tgaaatgatg      1800
     ccggcacaat taaaggaaac tactatgcat ccagaaaaaa gatcactttt aaaggttact      1860
     ttagaagatg tccagaatgt tgataaaata gtagatgatt tgatgggtaa aaagccagaa      1920
     aaaagatttc aatttattta tgaacaggct ttagttaaaa tggatcaaat tattaacaag      1980
     ttggatattt aa                                                          1992
//

If you have problems or comments...

PBIL Back to PBIL home page