(data stored in SCRATCH3701 zone)

EMBL: AE017197.PE10

AE017197.PE10        Location/Qualifiers
FT   CDS_pept        10275..11348
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RT0011"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RT0011"
FT                   /db_xref="EnsemblGenomes-Tr:AAU03500"
FT                   /db_xref="GOA:Q68XZ2"
FT                   /db_xref="InterPro:IPR011330"
FT                   /db_xref="InterPro:IPR022437"
FT                   /db_xref="UniProtKB/TrEMBL:Q68XZ2"
FT                   /protein_id="AAU03500.1"
FT                   /translation="MKRILSFIFIILFFNSSYTAEKAAVITDYKSVFLPVITKNKKIKI
FT                   AIRSYLKNKESYFVLVDPDSFKTEIVLQELVILPVNKIEKENMLIKLNKTAYIKALNKY
FT                   NFIDQSLRSFKQDEFSNKFTKNVIVHEHKPNSKNSYLSTFMNSTVQQNYGATSSMYKVK
FT                   GQFLTIDMCPSSKNFEEDFFKKLVELSTKLKKTIPITICVSGLWINKHTEEFLWLLKQQ
FT                   ENGYLQITWVNHSFSHPYFKDKPLENNFLLSNKEDFENEVLEVGKILVSYNIAPSPFFR
FT                   FPGLVSDQILIAKLKDFGFIPLGSNAWLAKGEKVQDGSFILVHGNSNEKAGIDLIMPML
FT                   SELKLLPIEKAFLPTNL"
     atgaaaagaa ttttaagttt tatttttatc atattgtttt ttaattcaag ttatactgct        60
     gaaaaagcgg cagtaataac tgattataaa tcggtatttt tgcctgtaat tactaaaaat       120
     aaaaaaataa aaattgctat tcgttcttat ttaaagaata aagaatcata tttcgtttta       180
     gtagatccag attcctttaa aactgagata gtactacaag aattggtaat tttacctgtg       240
     aataagatag aaaaagaaaa tatgctaata aagttaaata aaactgcata tattaaagct       300
     ttaaataaat ataactttat agatcaaagt ttacgaagct tcaaacagga tgaatttagt       360
     aataagttta ctaaaaatgt aatagtgcat gagcacaaac ctaactccaa aaattcgtat       420
     ttatcaactt ttatgaattc tactgtacaa caaaattatg gtgctactag tagcatgtat       480
     aaagtaaaag gtcagttctt aacaattgat atgtgtcctt cttccaaaaa ctttgaagaa       540
     gattttttta aaaagcttgt agaattatca acaaaattaa agaaaactat accgattact       600
     atatgtgttt caggattatg gattaataag catacagaag aatttttatg gttattaaag       660
     caacaagaaa acggttatct acaaataaca tgggttaatc attcatttag tcatccttac       720
     ttcaaagata aaccacttga aaataatttt cttctttcta ataaagaaga ttttgaaaat       780
     gaagtattag aagtaggaaa gatattagta agttataata ttgcaccgtc cccttttttt       840
     cgttttcctg gattagtttc tgatcaaata ttaatagcaa aactaaaaga ttttggattt       900
     attccgcttg gtagcaatgc atggcttgct aaaggtgaaa aagttcaaga tggttctttt       960
     atattggtac acggtaatag taacgaaaaa gccggaatag atttaattat gccgatgttg      1020
     tcagaattaa aattacttcc tattgaaaag gcatttttac cgacaaattt ataa            1074
//

If you have problems or comments...

PBIL Back to PBIL home page