(data stored in SCRATCH3701 zone)

EMBL: AE017197.PE110

AE017197.PE110       Location/Qualifiers
FT   CDS_pept        149053..149796
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RT0114"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RT0114"
FT                   /db_xref="EnsemblGenomes-Tr:AAU03600"
FT                   /db_xref="InterPro:IPR001763"
FT                   /db_xref="InterPro:IPR020936"
FT                   /db_xref="InterPro:IPR036873"
FT                   /db_xref="InterPro:IPR040503"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q68XP2"
FT                   /protein_id="AAU03600.1"
FT                   /translation="MNERIAILSAYSFVNIIEPANLIPKFLLIGKKKYIRGTILLANEG
FT                   FNCSFSGSYENVNLVLKQLIELTGSKDVNVKINYSSVHPFQKLKVRLKKEIIAMNVKDL
FT                   NIEVFKGDYIEPKDWDEFITKQNVIVIDTRNEYEIDIGTFKSAINPRTETFKQFPAWVQ
FT                   QNQALLQGKKIAMFCTGGIRCEKSTSLLKSIGYNEVYHLKGGILQYLEDTHNKNNLWQG
FT                   KCFVFDDRRAIMDDLSPAEGYWLHR"
     atgaatgaaa gaatagcaat tttaagtgca tatagttttg ttaatataat agaaccagcg        60
     aatttaatac ccaaattttt acttatcggt aaaaaaaaat acattagagg tactattttg       120
     ctagctaatg aaggttttaa ttgttctttt tcaggctcat atgaaaatgt aaatcttgta       180
     cttaaacaat tgatagagtt aacaggtagt aaagatgtga atgttaaaat aaattatagt       240
     tctgttcatc cttttcagaa gttgaaagta agacttaaga aagagatcat agcgatgaat       300
     gttaaagatt taaatattga ggtatttaaa ggtgactaca tagaaccaaa agattgggat       360
     gaatttatta ccaaacaaaa tgttatcgta atagatactc gtaatgagta tgaaatagat       420
     ataggtacct ttaaatcagc aattaatccg cgcactgaaa cgttcaaaca atttcctgct       480
     tgggttcagc aaaatcaagc actacttcaa ggcaagaaga tcgctatgtt ttgtacagga       540
     ggtattagat gtgaaaaatc cacaagtttg cttaaaagta taggttataa tgaggtatat       600
     catttaaaag gtggaatatt gcaatattta gaagatacgc acaacaagaa taatttatgg       660
     caaggtaagt gttttgtatt tgatgatagg agagcaatca tggatgattt atcgcctgca       720
     gaaggatatt ggctgcatag atag                                              744
//

If you have problems or comments...

PBIL Back to PBIL home page