(data stored in SCRATCH3701 zone)

EMBL: AE017197.PE130

AE017197.PE130       Location/Qualifiers
FT   CDS_pept        complement(175887..178010)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RT0135"
FT                   /product="rickettsial conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RT0135"
FT                   /db_xref="EnsemblGenomes-Tr:AAU03620"
FT                   /db_xref="UniProtKB/TrEMBL:Q68XM2"
FT                   /protein_id="AAU03620.1"
FT                   /translation="MSKAKTKQELLLQQELFNVLKTHDIEAHAKISRICERIAESVIAL
FT                   ADQQSHTTESSYINYINQAALNTKDLAKVTTTIKNFFPGDHNKKLREIIDTPLLQNLVI
FT                   AGSIERKIGLNDTLYTPDYRKLEEIIDPNDTKKVIDAMLRDKGVAQQDEFEKKGKKTTG
FT                   ISAGYIANDSAGNTFILKHFYKTHAACEKIQDPIEQSHAIDDRRDGVQELIGSTMYQFL
FT                   LHDRAPKEGLVKADAQHPDSLYVRSKFFDNAVTLTEFCGLSGQTRVRVNDKNLKKLEGF
FT                   EKAIAACHMLGDGDYHAGNLMVQNGKTITKIDHGRSFLEFHQDFGSMVQLTAEMFTHPN
FT                   VCYSDAIKAGNLSFNIDKYSEALNQMISQFDVQRMEAIVDQKLDELKKAGFDPDNIPLY
FT                   ININNFDDLKQYYKSSIKQNFINMQEIAKGAEIVKKFSNVLPEFKNGGWLEAFANSPVK
FT                   EPLLYAIKNKITIEGKDAQEWAYENNYQIKTAIGLTKEVIKERQWRKDFEGKWQEKEIE
FT                   VQRDKVEVQLSDPLKSMRIQDKFTAKKFESLIINFTKHTTTKNVTDEEVEKFYDNIMQV
FT                   LKKENYLNEQDIETIKQDLKYHDNIENTTHLLNAKDLKLNSKDTIYYKIGNFCEKIGLR
FT                   SVANHFIKKIAPENLNKIYNTEKVIAESIKIGNILKDNKQEGLQTKRLETVKGIVVSQL
FT                   QAKQGKQQQGKHY"
     atgtctaaag caaaaaccaa acaggaatta ttattacagc aagaactttt taatgtccta        60
     aaaactcacg atatagaagc tcatgccaaa atatccagaa tatgtgagag gattgcagaa       120
     tctgttattg cacttgcgga tcaacaatct catactactg aaagctcata tataaactat       180
     attaatcaag ccgctttaaa tactaaggat ttagctaaag ttacaacaac aataaaaaat       240
     ttcttcccag gagatcacaa caagaaatta agggaaataa tcgatacacc tcttttacag       300
     aatttagtta tagcaggatc aattgaacga aagattggat taaatgatac actatatacc       360
     ccagactata gaaaacttga agaaataata gaccctaatg acacaaaaaa agtaatcgat       420
     gccatgttac gtgataaggg agtagcacaa caagatgagt ttgagaagaa aggcaaaaag       480
     acaacaggaa tatcagctgg ttatattgct aatgatagtg ctggtaacac ttttatttta       540
     aaacactttt ataaaactca tgctgcgtgc gaaaaaatac aagatcctat tgaacagagc       600
     cacgctattg atgaccgaag agatggagtg caagaattaa taggctctac catgtatcaa       660
     tttttattac atgatcgcgc accaaaagaa ggtttggtaa aagcggacgc acaacaccct       720
     gattcacttt atgtacgttc taaatttttt gataatgctg taacgctaac agaattttgt       780
     ggtttatcag ggcaaactag agttagagtt aatgataaaa atttaaaaaa gttagaaggc       840
     tttgaaaaag ctatagctgc ttgtcatatg cttggggacg gagattatca tgctggtaat       900
     ttaatggtac aaaatggcaa aacaataacc aaaattgatc atgggcgctc ttttttagaa       960
     tttcatcagg attttggcag catggttcaa ttaacggctg aaatgttcac acatcccaat      1020
     gtttgctaca gtgatgctat taaagcaggt aatttatcat ttaatatcga taagtatagt      1080
     gaagcgttaa atcaaatgat aagtcaattt gatgtacaac gtatggaagc aatagttgat      1140
     caaaaacttg atgaactaaa gaaagctgga tttgacccgg acaatatccc attatacatc      1200
     aatattaaca attttgatga tttgaaacaa tactataaaa gtagtataaa acaaaacttt      1260
     attaatatgc aagaaatagc aaaaggagct gagatagtaa aaaaattcag taatgtttta      1320
     cctgaattta aaaacggtgg ttggttagag gcttttgcta attcacctgt aaaagaacca      1380
     ttactctatg caataaagaa taaaattaca attgaaggta aagatgctca agagtgggcg      1440
     tatgagaaca attatcaaat taaaactgct ataggattaa caaaagaagt aatcaaagaa      1500
     cgacaatggc gcaaagattt tgaaggtaaa tggcaagaaa aagaaattga ggttcaaaga      1560
     gataaagtag aagtgcaact ttctgatcct ttaaagtcaa tgcgtataca agacaaattt      1620
     acagctaaaa aatttgaatc gctaattatt aattttacaa agcacacaac aactaaaaat      1680
     gtaactgacg aagaagtaga aaaattctat gataatataa tgcaagtgct aaaaaaagag      1740
     aattatctta atgagcaaga tattgaaact ataaagcaag atttaaaata tcatgataat      1800
     atcgaaaata caacacacct attaaatgct aaagatttaa aattaaattc taaagatact      1860
     atatattaca agataggaaa tttttgtgaa aagataggtt tacgtagtgt tgcaaatcat      1920
     ttcataaaaa aaatcgctcc tgaaaattta aataaaattt ataatacaga aaaagtcata      1980
     gcagaaagta taaaaattgg taatatacta aaagataaca aacaagaagg actccaaacc      2040
     aaaagactag aaactgtaaa aggcattgta gtatctcaat tacaagctaa gcagggaaaa      2100
     cagcaacaag gtaagcatta ttga                                             2124
//

If you have problems or comments...

PBIL Back to PBIL home page