(data stored in SCRATCH3701 zone)

EMBL: AE017197.PE142

AE017197.PE142       Location/Qualifiers
FT   CDS_pept        188780..188983
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RT0147"
FT                   /product="rickettsial conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RT0147"
FT                   /db_xref="EnsemblGenomes-Tr:AAU03632"
FT                   /db_xref="InterPro:IPR024246"
FT                   /db_xref="UniProtKB/TrEMBL:Q68XL0"
FT                   /protein_id="AAU03632.1"
FT                   /translation="MQNPTQKVISFSEHKADIERIKKAIEEGWAIVKLVPNKDRFIGLL
FT                   EKVSDHKDETIYIPPRKKIIVK"
     atgcaaaatc caacgcaaaa ggttatatct ttttcagagc ataaagctga tatagaacgc        60
     atcaagaaag caatagaaga ggggtgggca atagtaaagt tagtacctaa taaagatcgt       120
     ttcattggac ttctagaaaa ggtttcggat cataaagatg aaacaattta tattcctcca       180
     agaaaaaaga taatagtgaa gtaa                                              204
//

If you have problems or comments...

PBIL Back to PBIL home page