(data stored in SCRATCH3701 zone)

EMBL: AE017197.PE150

AE017197.PE150       Location/Qualifiers
FT   CDS_pept        complement(196185..196379)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RT0156"
FT                   /product="rickettsial conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RT0156"
FT                   /db_xref="EnsemblGenomes-Tr:AAU03640"
FT                   /db_xref="UniProtKB/TrEMBL:Q68XK2"
FT                   /protein_id="AAU03640.1"
FT                   /translation="MLDYIVFSITRLVRSGAHTISDIVEFCTNTIDSISYTTHESIEDP
FT                   NLKEQDIEDDLVEVSLIGQ"
     atgttagatt atattgtttt tagtattact agattagtac gcagtggagc tcatactatt        60
     tcagatatag tggaattttg tactaacact attgatagta tttcatacac aactcatgaa       120
     agtatagaag accctaacct aaaggaacag gatatagaag atgatttagt agaagtatct       180
     ctaattgggc agtaa                                                        195
//

If you have problems or comments...

PBIL Back to PBIL home page